Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BKE3

Protein Details
Accession A0A2G5BKE3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-44QPRIDRACKMCRRRKVRCDGMRPSCNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MERGGNLASTTSQQSVAQPRIDRACKMCRRRKVRCDGMRPSCNFCITKKFECVYEPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.26
4 0.29
5 0.27
6 0.3
7 0.35
8 0.37
9 0.35
10 0.32
11 0.39
12 0.43
13 0.52
14 0.57
15 0.6
16 0.67
17 0.75
18 0.8
19 0.8
20 0.82
21 0.82
22 0.82
23 0.83
24 0.84
25 0.82
26 0.75
27 0.71
28 0.64
29 0.59
30 0.51
31 0.44
32 0.43
33 0.42
34 0.44
35 0.45
36 0.43
37 0.41