Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5B7F7

Protein Details
Accession A0A2G5B7F7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-125GVAKQQQQSRGKKKAHGKKRBasic
NLS Segment(s)
PositionSequence
101-125VKSGSGVAKQQQQSRGKKKAHGKKR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYYDNWDAFETAAVDLFSSAANKARYTVKYRNSDAALILKVTDDATCVQLRTEKLDDIRKIAHLHRQLAQTTSHRAQEIKGLAPMFPKREKPEAQSAAKVKSGSGVAKQQQQSRGKKKAHGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.07
6 0.07
7 0.07
8 0.11
9 0.13
10 0.13
11 0.15
12 0.21
13 0.25
14 0.32
15 0.4
16 0.43
17 0.49
18 0.52
19 0.55
20 0.51
21 0.48
22 0.42
23 0.37
24 0.29
25 0.21
26 0.18
27 0.13
28 0.11
29 0.1
30 0.09
31 0.06
32 0.06
33 0.09
34 0.09
35 0.09
36 0.09
37 0.12
38 0.13
39 0.16
40 0.17
41 0.16
42 0.19
43 0.26
44 0.26
45 0.25
46 0.26
47 0.23
48 0.24
49 0.24
50 0.27
51 0.24
52 0.26
53 0.28
54 0.29
55 0.28
56 0.27
57 0.29
58 0.24
59 0.27
60 0.27
61 0.24
62 0.22
63 0.22
64 0.21
65 0.24
66 0.24
67 0.19
68 0.19
69 0.18
70 0.17
71 0.22
72 0.24
73 0.23
74 0.25
75 0.29
76 0.32
77 0.39
78 0.41
79 0.42
80 0.5
81 0.53
82 0.52
83 0.54
84 0.53
85 0.49
86 0.49
87 0.43
88 0.33
89 0.28
90 0.27
91 0.22
92 0.23
93 0.28
94 0.29
95 0.38
96 0.43
97 0.45
98 0.52
99 0.59
100 0.65
101 0.67
102 0.72
103 0.7
104 0.74
105 0.79