Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BGL2

Protein Details
Accession A0A2G5BGL2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-72EAEEKRLQAKDKRKQKRKQREREKKRBasic
NLS Segment(s)
PositionSequence
52-72RLQAKDKRKQKRKQREREKKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences VSAEKEIENGRKVFQLFAARLFEQRVINAYREKMAHDLQRDLINELEAEEKRLQAKDKRKQKRKQREREKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.25
4 0.27
5 0.3
6 0.27
7 0.27
8 0.28
9 0.27
10 0.2
11 0.2
12 0.19
13 0.17
14 0.18
15 0.2
16 0.19
17 0.18
18 0.18
19 0.19
20 0.19
21 0.2
22 0.21
23 0.21
24 0.21
25 0.2
26 0.24
27 0.23
28 0.21
29 0.18
30 0.14
31 0.12
32 0.12
33 0.14
34 0.11
35 0.14
36 0.13
37 0.14
38 0.16
39 0.19
40 0.23
41 0.28
42 0.39
43 0.45
44 0.56
45 0.66
46 0.74
47 0.82
48 0.88
49 0.91
50 0.92
51 0.93
52 0.94