Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BE77

Protein Details
Accession A0A2G5BE77   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
9-34ATNFYIDKQRNKKRRLGHFADIREKVHydrophilic
178-199LEKFHKIPNPRPWQRVNKKDVLHydrophilic
NLS Segment(s)
PositionSequence
20-23KKRR
Subcellular Location(s) mito 18, mito_nucl 11.833, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSVSHLAPATNFYIDKQRNKKRRLGHFADIREKVKKNYPGNWIHAAEELLQNMCCSTVNPEKYKAYIKARSEVWELLDNFYNETVTTYAKSHPLHQKLHLSAYWNKVRANDRFAKGLHKKFGRDAVLIIGNWPAGMVRFHEPIRGKGWRDVLRRHGFTVYLLDEYKTSSLCPACGSGLEKFHKIPNPRPWQRVNKKDVLCNGLLRCKNKKLSEVCCEIQGFDSCAYVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.42
3 0.5
4 0.58
5 0.66
6 0.72
7 0.78
8 0.78
9 0.82
10 0.82
11 0.8
12 0.79
13 0.78
14 0.79
15 0.81
16 0.77
17 0.69
18 0.66
19 0.61
20 0.56
21 0.56
22 0.57
23 0.55
24 0.56
25 0.61
26 0.61
27 0.64
28 0.66
29 0.58
30 0.5
31 0.45
32 0.38
33 0.31
34 0.25
35 0.2
36 0.14
37 0.13
38 0.12
39 0.1
40 0.1
41 0.08
42 0.07
43 0.13
44 0.2
45 0.26
46 0.29
47 0.33
48 0.34
49 0.37
50 0.42
51 0.42
52 0.42
53 0.44
54 0.44
55 0.45
56 0.45
57 0.46
58 0.44
59 0.38
60 0.32
61 0.3
62 0.28
63 0.25
64 0.26
65 0.23
66 0.2
67 0.19
68 0.17
69 0.1
70 0.11
71 0.09
72 0.07
73 0.08
74 0.09
75 0.11
76 0.16
77 0.17
78 0.22
79 0.3
80 0.35
81 0.37
82 0.39
83 0.44
84 0.4
85 0.42
86 0.37
87 0.33
88 0.31
89 0.35
90 0.36
91 0.31
92 0.31
93 0.33
94 0.36
95 0.34
96 0.37
97 0.36
98 0.33
99 0.34
100 0.34
101 0.38
102 0.4
103 0.42
104 0.42
105 0.38
106 0.38
107 0.38
108 0.43
109 0.37
110 0.3
111 0.26
112 0.22
113 0.21
114 0.2
115 0.18
116 0.12
117 0.09
118 0.09
119 0.08
120 0.05
121 0.04
122 0.05
123 0.06
124 0.09
125 0.12
126 0.12
127 0.18
128 0.19
129 0.21
130 0.26
131 0.29
132 0.28
133 0.3
134 0.38
135 0.41
136 0.44
137 0.47
138 0.52
139 0.55
140 0.54
141 0.52
142 0.45
143 0.37
144 0.33
145 0.32
146 0.23
147 0.17
148 0.16
149 0.14
150 0.13
151 0.14
152 0.14
153 0.11
154 0.09
155 0.11
156 0.11
157 0.12
158 0.12
159 0.12
160 0.12
161 0.14
162 0.16
163 0.15
164 0.22
165 0.24
166 0.25
167 0.25
168 0.3
169 0.35
170 0.39
171 0.45
172 0.49
173 0.57
174 0.63
175 0.68
176 0.72
177 0.77
178 0.82
179 0.83
180 0.8
181 0.78
182 0.75
183 0.74
184 0.71
185 0.66
186 0.58
187 0.53
188 0.5
189 0.49
190 0.51
191 0.5
192 0.52
193 0.54
194 0.61
195 0.59
196 0.64
197 0.63
198 0.66
199 0.68
200 0.68
201 0.62
202 0.58
203 0.54
204 0.46
205 0.41
206 0.35
207 0.29
208 0.22
209 0.21