Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BH63

Protein Details
Accession A0A2G5BH63   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-43LQTPEPASTRKRRTHNKQDIQQRNEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018851  Borealin_N  
IPR018867  Cell_div_borealin  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10444  Nbl1_Borealin_N  
Amino Acid Sequences MSTVTPKARPNGQSAEKLQTPEPASTRKRRTHNKQDIQQRNEEQRQAMIENFDLEIEDKIRSMMVQLEADKMDLQLKADCEIAQLPKCVREMPLRKFLQEYGGEVSVAARGTLNLEDQDDALFASLPETPLAIRVRRKAMASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.5
4 0.5
5 0.44
6 0.41
7 0.38
8 0.35
9 0.34
10 0.36
11 0.4
12 0.48
13 0.56
14 0.58
15 0.65
16 0.72
17 0.79
18 0.82
19 0.86
20 0.87
21 0.86
22 0.89
23 0.89
24 0.83
25 0.8
26 0.75
27 0.72
28 0.67
29 0.61
30 0.5
31 0.42
32 0.39
33 0.32
34 0.27
35 0.19
36 0.14
37 0.13
38 0.12
39 0.1
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.08
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.1
58 0.09
59 0.09
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.1
66 0.09
67 0.08
68 0.1
69 0.12
70 0.12
71 0.14
72 0.13
73 0.15
74 0.16
75 0.16
76 0.17
77 0.23
78 0.3
79 0.34
80 0.44
81 0.42
82 0.43
83 0.44
84 0.41
85 0.38
86 0.31
87 0.27
88 0.21
89 0.21
90 0.2
91 0.18
92 0.17
93 0.13
94 0.12
95 0.1
96 0.06
97 0.05
98 0.07
99 0.08
100 0.09
101 0.08
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.07
109 0.06
110 0.05
111 0.06
112 0.07
113 0.07
114 0.07
115 0.08
116 0.07
117 0.13
118 0.17
119 0.22
120 0.28
121 0.34
122 0.4
123 0.43