Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5BCX5

Protein Details
Accession A0A2G5BCX5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-121ASTSNKNDGANKNKNKKKKLHydrophilic
NLS Segment(s)
PositionSequence
112-121NKNKNKKKKL
Subcellular Location(s) plas 9, mito 7, E.R. 7, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013945  Pkr1  
Gene Ontology GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF08636  Pkr1  
Amino Acid Sequences MSSKNTQQNPTESAGVFQDVINSIFQPGVNHGVMVVMNCAFLCLFVILGYLLFATRLNIHVCALTIIAGLLFASIQWFVMEMAASQRNKSPSSPSSPTPSRASTSNKNDGANKNKNKKKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.21
4 0.16
5 0.14
6 0.12
7 0.13
8 0.12
9 0.11
10 0.1
11 0.1
12 0.1
13 0.09
14 0.1
15 0.14
16 0.13
17 0.13
18 0.12
19 0.12
20 0.12
21 0.11
22 0.1
23 0.05
24 0.05
25 0.05
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.08
70 0.13
71 0.14
72 0.14
73 0.18
74 0.21
75 0.22
76 0.24
77 0.27
78 0.26
79 0.34
80 0.38
81 0.37
82 0.43
83 0.45
84 0.48
85 0.46
86 0.44
87 0.38
88 0.4
89 0.44
90 0.46
91 0.5
92 0.55
93 0.54
94 0.55
95 0.6
96 0.63
97 0.66
98 0.66
99 0.69
100 0.7
101 0.76