Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G5B118

Protein Details
Accession A0A2G5B118   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-85EKGHIARNRPRKQCGKRYSRKSCSQINNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences RDVDYVRDIMIRGSASKIQQVTCNENAMDIDAFEQRRQWTPMQKEQLERGLCFYCNEKGHIARNRPRKQCGKRYSRKSCSQINNVDVEDEEKASDEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.22
4 0.24
5 0.23
6 0.28
7 0.31
8 0.34
9 0.32
10 0.33
11 0.28
12 0.27
13 0.26
14 0.21
15 0.17
16 0.1
17 0.1
18 0.11
19 0.12
20 0.11
21 0.14
22 0.14
23 0.17
24 0.2
25 0.23
26 0.28
27 0.34
28 0.42
29 0.47
30 0.48
31 0.47
32 0.46
33 0.49
34 0.42
35 0.35
36 0.3
37 0.24
38 0.21
39 0.2
40 0.2
41 0.18
42 0.17
43 0.19
44 0.19
45 0.2
46 0.28
47 0.34
48 0.41
49 0.44
50 0.54
51 0.61
52 0.65
53 0.71
54 0.73
55 0.76
56 0.79
57 0.81
58 0.82
59 0.83
60 0.88
61 0.9
62 0.88
63 0.88
64 0.84
65 0.83
66 0.81
67 0.79
68 0.76
69 0.68
70 0.64
71 0.54
72 0.49
73 0.4
74 0.33
75 0.25
76 0.18
77 0.14
78 0.11