Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G5BCB1

Protein Details
Accession A0A2G5BCB1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30ILRAVPKQRTSHSKKRKRMANKGLKDRQDLHydrophilic
NLS Segment(s)
PositionSequence
9-23RTSHSKKRKRMANKG
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences ILRAVPKQRTSHSKKRKRMANKGLKDRQDLSPCPGCGRPKRAAHICRNCYGSIKQKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.86
5 0.88
6 0.88
7 0.88
8 0.87
9 0.88
10 0.86
11 0.8
12 0.74
13 0.65
14 0.6
15 0.55
16 0.47
17 0.41
18 0.39
19 0.35
20 0.34
21 0.35
22 0.36
23 0.37
24 0.41
25 0.44
26 0.44
27 0.53
28 0.6
29 0.65
30 0.69
31 0.73
32 0.72
33 0.69
34 0.67
35 0.6
36 0.55
37 0.53
38 0.52