Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7RW69

Protein Details
Accession Q7RW69    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-42AGATRVAKSRVKKPKPKKTALQRLMAQHydrophilic
NLS Segment(s)
PositionSequence
21-33VAKSRVKKPKPKK
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG ncr:NCU03499  -  
Amino Acid Sequences MVSSLFHLKLPSKVVAGATRVAKSRVKKPKPKKTALQRLMAQSKESLQKRTDEQLVVVQALKDQTAAALSAEGLAASLQADNEAMLEAAVPDASPTPGAGTTHKRVRNADSGVGSSVDSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.26
5 0.25
6 0.26
7 0.26
8 0.28
9 0.31
10 0.32
11 0.4
12 0.47
13 0.54
14 0.63
15 0.72
16 0.8
17 0.85
18 0.88
19 0.88
20 0.88
21 0.89
22 0.85
23 0.82
24 0.75
25 0.72
26 0.69
27 0.6
28 0.49
29 0.39
30 0.36
31 0.36
32 0.34
33 0.3
34 0.26
35 0.27
36 0.29
37 0.32
38 0.32
39 0.24
40 0.22
41 0.21
42 0.21
43 0.18
44 0.16
45 0.12
46 0.09
47 0.09
48 0.08
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.08
85 0.1
86 0.14
87 0.2
88 0.27
89 0.36
90 0.4
91 0.43
92 0.45
93 0.5
94 0.54
95 0.51
96 0.5
97 0.44
98 0.42
99 0.39
100 0.36