Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NIC3

Protein Details
Accession A0A2A9NIC3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-35APSGGGKAAKKKKWSKGKVKDKAQHVVNHydrophilic
NLS Segment(s)
PositionSequence
5-29KTPAPSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKTPAPSGGGKAAKKKKWSKGKVKDKAQHVVNLDKALHDRILKEVPTFKFISQSILIERLKINGSLARVAIKHLENEGQIRRIVHHSAQMVYTRVTAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.55
4 0.62
5 0.68
6 0.7
7 0.74
8 0.81
9 0.82
10 0.84
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.73
18 0.67
19 0.59
20 0.53
21 0.44
22 0.39
23 0.33
24 0.25
25 0.24
26 0.2
27 0.18
28 0.14
29 0.13
30 0.14
31 0.16
32 0.16
33 0.16
34 0.21
35 0.2
36 0.23
37 0.23
38 0.2
39 0.21
40 0.21
41 0.23
42 0.17
43 0.17
44 0.15
45 0.19
46 0.19
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.16
61 0.15
62 0.15
63 0.15
64 0.17
65 0.16
66 0.21
67 0.23
68 0.22
69 0.23
70 0.22
71 0.23
72 0.25
73 0.28
74 0.25
75 0.27
76 0.28
77 0.27
78 0.29
79 0.3
80 0.28
81 0.25
82 0.23
83 0.18