Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NFR7

Protein Details
Accession A0A2A9NFR7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
153-174DWSHLNSRRRRAREGKVAKDAWHydrophilic
NLS Segment(s)
PositionSequence
131-138RPKPKIPS
160-179RRRRAREGKVAKDAWGLKKE
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MTLYRNEAVRAGLSLVKKVINANLTPAGLTTTEIYKLVRNEPVSPDFQPPERDYSKTGSQPPHPEHPVRSIRYLKKTLLPMLQGNGLIKMSPVTRTEPVVVQDKKAGKFGAPSSTGQRKVWAWRPLDPNERPKPKIPSPPKRVFGEEVGVGEDWSHLNSRRRRAREGKVAKDAWGLKKELKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.19
5 0.19
6 0.22
7 0.22
8 0.21
9 0.23
10 0.25
11 0.24
12 0.23
13 0.21
14 0.18
15 0.14
16 0.15
17 0.11
18 0.1
19 0.11
20 0.12
21 0.12
22 0.15
23 0.17
24 0.19
25 0.24
26 0.24
27 0.26
28 0.3
29 0.33
30 0.33
31 0.32
32 0.34
33 0.3
34 0.31
35 0.33
36 0.3
37 0.34
38 0.33
39 0.32
40 0.3
41 0.33
42 0.36
43 0.36
44 0.4
45 0.38
46 0.41
47 0.47
48 0.5
49 0.52
50 0.5
51 0.48
52 0.44
53 0.48
54 0.5
55 0.44
56 0.46
57 0.46
58 0.48
59 0.53
60 0.54
61 0.47
62 0.44
63 0.45
64 0.42
65 0.37
66 0.33
67 0.27
68 0.25
69 0.24
70 0.19
71 0.16
72 0.13
73 0.11
74 0.08
75 0.07
76 0.07
77 0.06
78 0.07
79 0.08
80 0.11
81 0.12
82 0.13
83 0.14
84 0.14
85 0.16
86 0.23
87 0.22
88 0.2
89 0.24
90 0.27
91 0.27
92 0.28
93 0.26
94 0.18
95 0.21
96 0.22
97 0.22
98 0.2
99 0.21
100 0.25
101 0.32
102 0.34
103 0.31
104 0.32
105 0.29
106 0.34
107 0.41
108 0.41
109 0.37
110 0.41
111 0.47
112 0.51
113 0.57
114 0.56
115 0.58
116 0.61
117 0.66
118 0.62
119 0.62
120 0.64
121 0.63
122 0.68
123 0.69
124 0.7
125 0.73
126 0.79
127 0.79
128 0.74
129 0.71
130 0.64
131 0.56
132 0.49
133 0.4
134 0.31
135 0.27
136 0.23
137 0.19
138 0.15
139 0.13
140 0.09
141 0.09
142 0.11
143 0.15
144 0.24
145 0.31
146 0.41
147 0.51
148 0.56
149 0.65
150 0.71
151 0.76
152 0.78
153 0.82
154 0.81
155 0.8
156 0.76
157 0.68
158 0.66
159 0.62
160 0.59
161 0.53
162 0.47