Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NP58

Protein Details
Accession A0A2A9NP58    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-80MEPRRSSRIKEQPKPETAPKKVTKPRTKKADKEKQEGEKVEDKDKEEKPKSARGRKRKNEETNGAPBasic
NLS Segment(s)
PositionSequence
18-73RRSSRIKEQPKPETAPKKVTKPRTKKADKEKQEGEKVEDKDKEEKPKSARGRKRKN
95-156AKKAKPASKAKEPSSKPSSAAAVKPSSKAAVKPSSKVSAKPVSRGASAKPPSRATSKKPASK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPRKAAAAATGETGMEPRRSSRIKEQPKPETAPKKVTKPRTKKADKEKQEGEKVEDKDKEEKPKSARGRKRKNEETNGAPEAVEGQAAEGEEPTAKKAKPASKAKEPSSKPSSAAAVKPSSKAAVKPSSKVSAKPVSRGASAKPPSRATSKKPASKADGQNKEAAQAPNNVAPITEEPENEAQGDAAPANEAAPAAEEAQLIGLPHLPSCPLNLSSVYSCGSLLVTQAALHKTTSGRHVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.16
5 0.24
6 0.27
7 0.33
8 0.42
9 0.5
10 0.59
11 0.67
12 0.74
13 0.75
14 0.8
15 0.81
16 0.8
17 0.79
18 0.74
19 0.75
20 0.72
21 0.73
22 0.75
23 0.79
24 0.8
25 0.8
26 0.84
27 0.85
28 0.88
29 0.87
30 0.89
31 0.89
32 0.87
33 0.86
34 0.85
35 0.82
36 0.81
37 0.74
38 0.68
39 0.65
40 0.59
41 0.57
42 0.51
43 0.46
44 0.46
45 0.49
46 0.53
47 0.49
48 0.53
49 0.51
50 0.57
51 0.64
52 0.66
53 0.71
54 0.72
55 0.79
56 0.83
57 0.89
58 0.9
59 0.89
60 0.88
61 0.84
62 0.79
63 0.74
64 0.66
65 0.55
66 0.44
67 0.34
68 0.26
69 0.19
70 0.13
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.05
79 0.05
80 0.07
81 0.1
82 0.1
83 0.12
84 0.19
85 0.24
86 0.33
87 0.42
88 0.47
89 0.54
90 0.61
91 0.64
92 0.67
93 0.63
94 0.62
95 0.58
96 0.53
97 0.44
98 0.39
99 0.37
100 0.29
101 0.29
102 0.24
103 0.22
104 0.22
105 0.21
106 0.2
107 0.18
108 0.17
109 0.17
110 0.19
111 0.24
112 0.25
113 0.26
114 0.29
115 0.34
116 0.34
117 0.34
118 0.35
119 0.35
120 0.34
121 0.35
122 0.37
123 0.33
124 0.34
125 0.34
126 0.3
127 0.3
128 0.34
129 0.35
130 0.34
131 0.35
132 0.35
133 0.41
134 0.43
135 0.4
136 0.46
137 0.51
138 0.53
139 0.55
140 0.57
141 0.56
142 0.61
143 0.65
144 0.64
145 0.64
146 0.59
147 0.59
148 0.54
149 0.49
150 0.45
151 0.37
152 0.28
153 0.24
154 0.24
155 0.22
156 0.23
157 0.21
158 0.16
159 0.17
160 0.16
161 0.16
162 0.15
163 0.13
164 0.15
165 0.17
166 0.17
167 0.16
168 0.14
169 0.11
170 0.1
171 0.1
172 0.07
173 0.06
174 0.06
175 0.05
176 0.05
177 0.06
178 0.05
179 0.04
180 0.06
181 0.07
182 0.07
183 0.08
184 0.08
185 0.07
186 0.08
187 0.09
188 0.07
189 0.07
190 0.09
191 0.08
192 0.09
193 0.09
194 0.11
195 0.1
196 0.13
197 0.16
198 0.14
199 0.16
200 0.17
201 0.21
202 0.21
203 0.22
204 0.22
205 0.18
206 0.17
207 0.15
208 0.15
209 0.11
210 0.1
211 0.1
212 0.08
213 0.09
214 0.13
215 0.15
216 0.15
217 0.15
218 0.17
219 0.18
220 0.21