Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S045

Protein Details
Accession Q7S045    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
3-30KAAAKSKTTGKVEKRRAKKDPNAPKRGLBasic
NLS Segment(s)
PositionSequence
6-28AKSKTTGKVEKRRAKKDPNAPKR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG ncr:NCU09995  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAAAKSKTTGKVEKRRAKKDPNAPKRGLSAYMFFANEQRENVREENPGVSFGQVGKILGERWKALSDKQRAPYEAKAAADKKRYEDEKQAYNAEADEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.82
5 0.85
6 0.86
7 0.86
8 0.86
9 0.86
10 0.87
11 0.86
12 0.79
13 0.72
14 0.66
15 0.58
16 0.51
17 0.42
18 0.33
19 0.27
20 0.27
21 0.24
22 0.2
23 0.2
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.17
30 0.19
31 0.18
32 0.17
33 0.17
34 0.17
35 0.16
36 0.16
37 0.13
38 0.11
39 0.1
40 0.08
41 0.09
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.1
48 0.11
49 0.1
50 0.11
51 0.14
52 0.15
53 0.19
54 0.27
55 0.32
56 0.38
57 0.44
58 0.47
59 0.47
60 0.5
61 0.49
62 0.45
63 0.41
64 0.35
65 0.35
66 0.35
67 0.39
68 0.42
69 0.4
70 0.39
71 0.44
72 0.48
73 0.46
74 0.52
75 0.52
76 0.53
77 0.55
78 0.53
79 0.46
80 0.42
81 0.37
82 0.29
83 0.23