Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NN63

Protein Details
Accession A0A2A9NN63    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
241-261AERPESSRRARDKEQRNVESKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, cysk 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037445  MAGE  
IPR041899  MAGE_WH2  
IPR002190  MHD_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01454  MAGE  
Amino Acid Sequences MELIELPTRANISQDPDGPGDELDVACRTAGVRRKVTTAGSKTYMLRSTLDPQLLEIAARTDERILEIEAGEAPSDDDSDDDDLLEGGYTPRFYGSIISWTHGEQPGAIGILYVILALILVHGRVIRDMDLRMNLRRLRLPTGGEVTFSALSTHKTLTIDQYLSSLMRQNYIDREQIGEGKSKGIKRGRVATQAPQDDEEGAAYQWRWGPRAYCEIGEKAVAKFIAEFMFDDRDADADEEAERPESSRRARDKEQRNVESKVSKMLDGIEKAAGGNLTGLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.3
5 0.28
6 0.26
7 0.2
8 0.17
9 0.14
10 0.12
11 0.12
12 0.11
13 0.1
14 0.1
15 0.1
16 0.15
17 0.23
18 0.29
19 0.34
20 0.35
21 0.39
22 0.42
23 0.46
24 0.49
25 0.47
26 0.45
27 0.42
28 0.43
29 0.41
30 0.44
31 0.41
32 0.33
33 0.3
34 0.28
35 0.3
36 0.32
37 0.32
38 0.27
39 0.24
40 0.25
41 0.23
42 0.19
43 0.14
44 0.11
45 0.1
46 0.1
47 0.1
48 0.08
49 0.09
50 0.1
51 0.11
52 0.1
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.05
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.08
83 0.13
84 0.14
85 0.15
86 0.15
87 0.16
88 0.19
89 0.18
90 0.17
91 0.11
92 0.11
93 0.1
94 0.1
95 0.09
96 0.05
97 0.04
98 0.04
99 0.04
100 0.03
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.04
112 0.05
113 0.05
114 0.07
115 0.08
116 0.09
117 0.12
118 0.14
119 0.15
120 0.2
121 0.2
122 0.21
123 0.24
124 0.24
125 0.25
126 0.25
127 0.25
128 0.22
129 0.25
130 0.23
131 0.2
132 0.18
133 0.15
134 0.13
135 0.12
136 0.11
137 0.07
138 0.09
139 0.09
140 0.09
141 0.09
142 0.1
143 0.1
144 0.12
145 0.15
146 0.14
147 0.13
148 0.13
149 0.13
150 0.12
151 0.12
152 0.14
153 0.11
154 0.13
155 0.13
156 0.14
157 0.18
158 0.2
159 0.21
160 0.17
161 0.19
162 0.18
163 0.21
164 0.2
165 0.19
166 0.17
167 0.19
168 0.22
169 0.22
170 0.29
171 0.31
172 0.35
173 0.35
174 0.43
175 0.44
176 0.48
177 0.5
178 0.49
179 0.52
180 0.5
181 0.47
182 0.4
183 0.36
184 0.28
185 0.26
186 0.19
187 0.12
188 0.09
189 0.09
190 0.07
191 0.09
192 0.11
193 0.13
194 0.13
195 0.14
196 0.17
197 0.19
198 0.27
199 0.27
200 0.26
201 0.28
202 0.28
203 0.28
204 0.28
205 0.26
206 0.19
207 0.19
208 0.17
209 0.14
210 0.13
211 0.13
212 0.12
213 0.11
214 0.12
215 0.11
216 0.14
217 0.14
218 0.14
219 0.13
220 0.12
221 0.13
222 0.13
223 0.11
224 0.08
225 0.09
226 0.09
227 0.1
228 0.11
229 0.1
230 0.1
231 0.14
232 0.2
233 0.25
234 0.34
235 0.41
236 0.48
237 0.57
238 0.66
239 0.73
240 0.77
241 0.82
242 0.81
243 0.79
244 0.75
245 0.73
246 0.68
247 0.59
248 0.57
249 0.48
250 0.4
251 0.35
252 0.35
253 0.35
254 0.31
255 0.32
256 0.24
257 0.22
258 0.22
259 0.22
260 0.18
261 0.11