Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NEL9

Protein Details
Accession A0A2A9NEL9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
12-32PIPNLNKKSRGRKVPYIPALRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences KRKHNPIPQPVPIPNLNKKSRGRKVPYIPALRGADGLSQVEGVATGPDGEERTFVCVVPGCGKCFIRGEHLKRHIRSIHTDDKPHVCPFKRCGKTFSRKDNLGQHVRIHLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.57
4 0.58
5 0.63
6 0.69
7 0.72
8 0.75
9 0.74
10 0.75
11 0.79
12 0.81
13 0.82
14 0.78
15 0.69
16 0.66
17 0.59
18 0.5
19 0.42
20 0.32
21 0.23
22 0.17
23 0.17
24 0.09
25 0.08
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.08
40 0.09
41 0.08
42 0.09
43 0.08
44 0.09
45 0.15
46 0.16
47 0.14
48 0.17
49 0.17
50 0.18
51 0.2
52 0.2
53 0.22
54 0.3
55 0.33
56 0.4
57 0.49
58 0.55
59 0.54
60 0.59
61 0.56
62 0.51
63 0.53
64 0.51
65 0.52
66 0.49
67 0.51
68 0.49
69 0.5
70 0.51
71 0.48
72 0.48
73 0.42
74 0.43
75 0.46
76 0.53
77 0.55
78 0.54
79 0.56
80 0.59
81 0.66
82 0.7
83 0.75
84 0.73
85 0.68
86 0.72
87 0.76
88 0.75
89 0.72
90 0.66
91 0.59