Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NWY0

Protein Details
Accession A0A2A9NWY0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
205-237VTPIGVNRRHSHRRRRKNKSNLRRTPPTFWRPDHydrophilic
NLS Segment(s)
PositionSequence
212-228RRHSHRRRRKNKSNLRR
Subcellular Location(s) nucl 17.5, mito_nucl 12.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MIPHTVNPYRLPQSFKFVSRADLDVDQSLSTSPMYNSNDVNVISKLNKVLEKALPVATPERETNSIEDTQNLDKSKTINNVVKAANHVVVFRLVSSKPMPLSLVPKPVPPLTEPDCEDTEAAAALRKQRAEAVAVDYSRLLHESKKSSNAPRYPIHNVPLLKANCAIHDLPPFLILSNPRPAQKLRSTVFPTWPIKHSILEVKDVTPIGVNRRHSHRRRRKNKSNLRRTPPTFWRPDTTWRGKCLGYAMGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.48
4 0.42
5 0.43
6 0.39
7 0.38
8 0.33
9 0.3
10 0.29
11 0.25
12 0.24
13 0.2
14 0.17
15 0.16
16 0.13
17 0.11
18 0.1
19 0.09
20 0.16
21 0.19
22 0.21
23 0.21
24 0.22
25 0.24
26 0.23
27 0.25
28 0.18
29 0.18
30 0.16
31 0.18
32 0.18
33 0.19
34 0.2
35 0.19
36 0.23
37 0.23
38 0.24
39 0.25
40 0.25
41 0.22
42 0.22
43 0.24
44 0.21
45 0.21
46 0.2
47 0.21
48 0.22
49 0.23
50 0.23
51 0.23
52 0.25
53 0.22
54 0.22
55 0.22
56 0.22
57 0.25
58 0.24
59 0.21
60 0.19
61 0.21
62 0.24
63 0.26
64 0.3
65 0.3
66 0.32
67 0.36
68 0.36
69 0.35
70 0.32
71 0.29
72 0.25
73 0.2
74 0.18
75 0.14
76 0.13
77 0.12
78 0.1
79 0.11
80 0.09
81 0.11
82 0.12
83 0.13
84 0.13
85 0.13
86 0.14
87 0.13
88 0.18
89 0.18
90 0.24
91 0.23
92 0.23
93 0.25
94 0.25
95 0.25
96 0.21
97 0.24
98 0.21
99 0.24
100 0.24
101 0.25
102 0.25
103 0.24
104 0.23
105 0.18
106 0.13
107 0.1
108 0.08
109 0.06
110 0.06
111 0.08
112 0.1
113 0.1
114 0.1
115 0.11
116 0.12
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.14
123 0.13
124 0.13
125 0.11
126 0.11
127 0.08
128 0.08
129 0.12
130 0.16
131 0.19
132 0.25
133 0.29
134 0.35
135 0.42
136 0.44
137 0.45
138 0.44
139 0.47
140 0.48
141 0.46
142 0.42
143 0.39
144 0.36
145 0.32
146 0.37
147 0.32
148 0.27
149 0.26
150 0.24
151 0.19
152 0.22
153 0.21
154 0.16
155 0.18
156 0.18
157 0.15
158 0.15
159 0.15
160 0.12
161 0.13
162 0.13
163 0.14
164 0.2
165 0.22
166 0.23
167 0.26
168 0.27
169 0.32
170 0.36
171 0.41
172 0.36
173 0.42
174 0.47
175 0.48
176 0.51
177 0.52
178 0.51
179 0.46
180 0.47
181 0.43
182 0.39
183 0.36
184 0.35
185 0.34
186 0.3
187 0.32
188 0.31
189 0.27
190 0.28
191 0.27
192 0.24
193 0.19
194 0.19
195 0.21
196 0.25
197 0.3
198 0.32
199 0.42
200 0.52
201 0.58
202 0.68
203 0.73
204 0.78
205 0.85
206 0.91
207 0.93
208 0.93
209 0.96
210 0.96
211 0.96
212 0.95
213 0.93
214 0.93
215 0.88
216 0.86
217 0.85
218 0.83
219 0.8
220 0.74
221 0.71
222 0.65
223 0.68
224 0.69
225 0.7
226 0.66
227 0.62
228 0.61
229 0.54
230 0.51
231 0.45