Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NPE2

Protein Details
Accession A0A2A9NPE2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
173-204PKINKISGVQQKKRDPNWKKGKGKDNTKSNSTHydrophilic
NLS Segment(s)
PositionSequence
184-196KKRDPNWKKGKGK
Subcellular Location(s) nucl 13.5, mito_nucl 10.666, cyto_nucl 10.333, mito 6.5, cyto 5
Family & Domain DBs
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
Amino Acid Sequences MDGTNYTLWEYPMRAYLKFKGYWLITDKYYNLNNGAKGSIKQRLSNAIIEEIKDLSSAKEIWKHLEDKYNKARSAQVFGDIQKVYAFQIKGNQNPEAEISKLALLFACLKAQGAEMSKFYQAMTLLNAGSMKWPHLVSIYLSQHEMKELDFDKIKVMFVADWHRTTTLGQPTPKINKISGVQQKKRDPNWKKGKGKDNTKSNSTTSPSPSSNSKPSSRRKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.32
4 0.36
5 0.36
6 0.36
7 0.36
8 0.34
9 0.38
10 0.39
11 0.36
12 0.32
13 0.34
14 0.34
15 0.33
16 0.34
17 0.3
18 0.3
19 0.3
20 0.29
21 0.28
22 0.28
23 0.24
24 0.24
25 0.27
26 0.3
27 0.29
28 0.31
29 0.31
30 0.37
31 0.38
32 0.39
33 0.35
34 0.33
35 0.31
36 0.29
37 0.28
38 0.21
39 0.18
40 0.15
41 0.14
42 0.09
43 0.1
44 0.1
45 0.12
46 0.17
47 0.18
48 0.22
49 0.26
50 0.27
51 0.28
52 0.36
53 0.37
54 0.39
55 0.48
56 0.51
57 0.48
58 0.47
59 0.5
60 0.43
61 0.45
62 0.37
63 0.31
64 0.26
65 0.26
66 0.29
67 0.23
68 0.22
69 0.16
70 0.16
71 0.13
72 0.15
73 0.15
74 0.11
75 0.18
76 0.22
77 0.25
78 0.28
79 0.29
80 0.25
81 0.25
82 0.26
83 0.2
84 0.17
85 0.13
86 0.11
87 0.1
88 0.1
89 0.09
90 0.07
91 0.06
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.08
101 0.08
102 0.09
103 0.11
104 0.11
105 0.11
106 0.1
107 0.1
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.08
114 0.08
115 0.07
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.1
124 0.1
125 0.18
126 0.19
127 0.18
128 0.19
129 0.19
130 0.18
131 0.19
132 0.17
133 0.1
134 0.13
135 0.13
136 0.15
137 0.16
138 0.16
139 0.17
140 0.18
141 0.18
142 0.13
143 0.13
144 0.1
145 0.12
146 0.19
147 0.19
148 0.2
149 0.21
150 0.21
151 0.21
152 0.22
153 0.26
154 0.27
155 0.3
156 0.3
157 0.32
158 0.39
159 0.45
160 0.49
161 0.45
162 0.36
163 0.36
164 0.37
165 0.44
166 0.47
167 0.51
168 0.53
169 0.6
170 0.68
171 0.72
172 0.79
173 0.8
174 0.78
175 0.78
176 0.82
177 0.84
178 0.84
179 0.84
180 0.86
181 0.85
182 0.89
183 0.87
184 0.86
185 0.82
186 0.79
187 0.74
188 0.67
189 0.63
190 0.57
191 0.53
192 0.48
193 0.48
194 0.44
195 0.43
196 0.46
197 0.46
198 0.5
199 0.51
200 0.54
201 0.56