Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NMG4

Protein Details
Accession A0A2A9NMG4    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSSEQPNKQPQPQPNQDHPFPHydrophilic
137-168GDTCRDGQRKERKKGIKRGPYKRKNKNGEASSBasic
342-366GTSTGTKKRTRGKGGEPKAKRTKVGBasic
NLS Segment(s)
PositionSequence
145-163RKERKKGIKRGPYKRKNKN
348-373KKRTRGKGGEPKAKRTKVGRAGKDKE
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSSSEQPNKQPQPQPNQDHPFPPPVVAYTPQPFNGATYTSPPPPGAYPPPFIAYPPPPDANHPENGQNGVPPMAPPYMMAFPPPDVPVPPGAPVQAPAALIKPKRKQVKMACTNCAAACKRCDEGRPCERCQKYGIGDTCRDGQRKERKKGIKRGPYKRKNKNGEASSSAAGSSPSPQWNPAAGHSPATATTTAAIHAVAQFASPEGYYGPIYYPPPGAFLPHHPHEVPSGQEGSQPPANGQPPMMPYFLHAGIYPPYPTAYGHPALYPGALPPAQQPQQQPQPPQQHTQPQPPQPAQPPLHVSPQAVNGVEPSSVAEGKKKEGSSTANGVAENAATPGPSGTSTGTKKRTRGKGGEPKAKRTKVGRAGKDKEGGGGQDGSAGGPSSSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.81
4 0.76
5 0.73
6 0.68
7 0.64
8 0.55
9 0.48
10 0.38
11 0.32
12 0.32
13 0.29
14 0.31
15 0.29
16 0.31
17 0.31
18 0.31
19 0.29
20 0.27
21 0.26
22 0.22
23 0.18
24 0.2
25 0.24
26 0.24
27 0.26
28 0.25
29 0.25
30 0.25
31 0.3
32 0.33
33 0.33
34 0.35
35 0.35
36 0.38
37 0.36
38 0.35
39 0.35
40 0.31
41 0.33
42 0.35
43 0.36
44 0.34
45 0.39
46 0.45
47 0.42
48 0.42
49 0.38
50 0.37
51 0.35
52 0.37
53 0.32
54 0.26
55 0.23
56 0.2
57 0.18
58 0.14
59 0.15
60 0.13
61 0.12
62 0.12
63 0.14
64 0.15
65 0.15
66 0.16
67 0.15
68 0.15
69 0.17
70 0.18
71 0.16
72 0.14
73 0.16
74 0.18
75 0.17
76 0.18
77 0.16
78 0.16
79 0.15
80 0.15
81 0.15
82 0.13
83 0.13
84 0.11
85 0.14
86 0.18
87 0.22
88 0.29
89 0.34
90 0.41
91 0.5
92 0.52
93 0.58
94 0.63
95 0.71
96 0.73
97 0.73
98 0.69
99 0.62
100 0.61
101 0.52
102 0.49
103 0.41
104 0.33
105 0.29
106 0.28
107 0.28
108 0.28
109 0.34
110 0.33
111 0.4
112 0.47
113 0.51
114 0.52
115 0.6
116 0.59
117 0.54
118 0.51
119 0.47
120 0.41
121 0.42
122 0.43
123 0.38
124 0.38
125 0.38
126 0.41
127 0.4
128 0.38
129 0.31
130 0.35
131 0.41
132 0.5
133 0.55
134 0.59
135 0.65
136 0.73
137 0.82
138 0.83
139 0.83
140 0.83
141 0.87
142 0.89
143 0.89
144 0.9
145 0.9
146 0.9
147 0.88
148 0.86
149 0.84
150 0.77
151 0.71
152 0.64
153 0.56
154 0.46
155 0.38
156 0.29
157 0.2
158 0.16
159 0.12
160 0.1
161 0.1
162 0.11
163 0.12
164 0.13
165 0.13
166 0.16
167 0.16
168 0.16
169 0.18
170 0.17
171 0.17
172 0.16
173 0.16
174 0.13
175 0.14
176 0.13
177 0.07
178 0.08
179 0.07
180 0.07
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.06
197 0.06
198 0.08
199 0.09
200 0.09
201 0.11
202 0.09
203 0.12
204 0.12
205 0.13
206 0.12
207 0.17
208 0.23
209 0.24
210 0.26
211 0.24
212 0.24
213 0.25
214 0.25
215 0.2
216 0.16
217 0.16
218 0.13
219 0.17
220 0.17
221 0.18
222 0.19
223 0.17
224 0.16
225 0.19
226 0.2
227 0.17
228 0.17
229 0.15
230 0.16
231 0.18
232 0.18
233 0.13
234 0.13
235 0.16
236 0.16
237 0.15
238 0.12
239 0.11
240 0.12
241 0.14
242 0.13
243 0.1
244 0.1
245 0.1
246 0.11
247 0.12
248 0.15
249 0.15
250 0.15
251 0.15
252 0.16
253 0.15
254 0.15
255 0.13
256 0.08
257 0.1
258 0.09
259 0.1
260 0.11
261 0.18
262 0.21
263 0.24
264 0.27
265 0.32
266 0.41
267 0.46
268 0.48
269 0.49
270 0.57
271 0.57
272 0.59
273 0.58
274 0.58
275 0.58
276 0.65
277 0.64
278 0.61
279 0.66
280 0.63
281 0.63
282 0.59
283 0.63
284 0.55
285 0.51
286 0.51
287 0.45
288 0.49
289 0.45
290 0.4
291 0.33
292 0.35
293 0.33
294 0.26
295 0.23
296 0.18
297 0.17
298 0.16
299 0.13
300 0.1
301 0.1
302 0.12
303 0.12
304 0.17
305 0.17
306 0.22
307 0.27
308 0.27
309 0.26
310 0.29
311 0.33
312 0.33
313 0.37
314 0.37
315 0.33
316 0.33
317 0.32
318 0.27
319 0.22
320 0.17
321 0.12
322 0.08
323 0.06
324 0.07
325 0.06
326 0.07
327 0.07
328 0.08
329 0.1
330 0.17
331 0.23
332 0.31
333 0.4
334 0.45
335 0.51
336 0.6
337 0.68
338 0.7
339 0.73
340 0.76
341 0.78
342 0.83
343 0.86
344 0.82
345 0.83
346 0.84
347 0.8
348 0.76
349 0.71
350 0.71
351 0.71
352 0.76
353 0.75
354 0.75
355 0.77
356 0.77
357 0.76
358 0.66
359 0.59
360 0.51
361 0.42
362 0.35
363 0.3
364 0.23
365 0.19
366 0.19
367 0.16
368 0.14
369 0.13
370 0.09