Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NG23

Protein Details
Accession A0A2A9NG23    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
94-113RRGGKVKKGNAKQKQKHPETBasic
223-249PKSVKSRERFYKERLKKLKIRSARGIWHydrophilic
NLS Segment(s)
PositionSequence
94-111RRGGKVKKGNAKQKQKHP
228-243SRERFYKERLKKLKIR
Subcellular Location(s) mito 12.5, cyto_mito 10.333, cyto 7, extr 5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MRPNLSCILLWSGVLIAISSAAPAGLSSEGESDLALRDIDGHIGLSTRDLYDVPYEYLERDLVDYGDGLYQRELYDGGEVLYERDGKDESELVRRGGKVKKGNAKQKQKHPETEKGCKEKETKGNEKVIECSSYEEAAMEACKFVNGGSEKINPAKLDLYQGRLKASPGHGQIVGLGYKSAAGNVVPFIRLDMDSTGKAVHFNAVQLSDSSKKLAAIIRDTVPKSVKSRERFYKERLKKLKIRSARGIWNWWSTGNSNHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.07
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.12
39 0.13
40 0.13
41 0.14
42 0.14
43 0.14
44 0.15
45 0.14
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.08
71 0.09
72 0.09
73 0.09
74 0.1
75 0.12
76 0.12
77 0.18
78 0.19
79 0.19
80 0.21
81 0.22
82 0.26
83 0.28
84 0.34
85 0.34
86 0.4
87 0.49
88 0.55
89 0.65
90 0.69
91 0.76
92 0.77
93 0.8
94 0.83
95 0.79
96 0.79
97 0.76
98 0.75
99 0.71
100 0.73
101 0.71
102 0.67
103 0.62
104 0.57
105 0.54
106 0.52
107 0.52
108 0.51
109 0.5
110 0.49
111 0.53
112 0.51
113 0.48
114 0.44
115 0.37
116 0.3
117 0.22
118 0.2
119 0.15
120 0.13
121 0.12
122 0.1
123 0.08
124 0.07
125 0.07
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.09
133 0.1
134 0.11
135 0.13
136 0.16
137 0.17
138 0.19
139 0.21
140 0.16
141 0.16
142 0.15
143 0.13
144 0.17
145 0.17
146 0.21
147 0.22
148 0.23
149 0.23
150 0.23
151 0.23
152 0.21
153 0.23
154 0.24
155 0.23
156 0.24
157 0.22
158 0.22
159 0.22
160 0.2
161 0.17
162 0.11
163 0.09
164 0.06
165 0.07
166 0.07
167 0.07
168 0.05
169 0.05
170 0.05
171 0.07
172 0.08
173 0.07
174 0.07
175 0.08
176 0.09
177 0.09
178 0.1
179 0.1
180 0.12
181 0.12
182 0.13
183 0.13
184 0.12
185 0.12
186 0.11
187 0.12
188 0.1
189 0.1
190 0.12
191 0.12
192 0.12
193 0.12
194 0.16
195 0.16
196 0.17
197 0.18
198 0.16
199 0.16
200 0.18
201 0.21
202 0.21
203 0.22
204 0.25
205 0.27
206 0.33
207 0.34
208 0.36
209 0.35
210 0.36
211 0.36
212 0.41
213 0.46
214 0.47
215 0.55
216 0.62
217 0.67
218 0.69
219 0.73
220 0.75
221 0.76
222 0.8
223 0.8
224 0.79
225 0.79
226 0.83
227 0.85
228 0.84
229 0.83
230 0.81
231 0.79
232 0.8
233 0.77
234 0.74
235 0.68
236 0.64
237 0.57
238 0.49
239 0.44
240 0.37