Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NCK2

Protein Details
Accession A0A2A9NCK2   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
153-172RNTGRKGWRDWEKNNRNRESHydrophilic
NLS Segment(s)
PositionSequence
114-148PRKGSSFVRGRSGARGGASYNARGGSRGGRGGMGR
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 8.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007783  eIF3d  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0098808  F:mRNA cap binding  
GO:0003743  F:translation initiation factor activity  
GO:0002191  P:cap-dependent translational initiation  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF05091  eIF-3_zeta  
Amino Acid Sequences MSSFSLPPIVDNPDGGWGPSAANLPEQFKFKDIPYAPYSKADKLGRFADWNESTLDTRQSATGVPATQSTRTGATGRRRDGAPTFGSGTASAFAYFHVEDESSFSLVDNKPAPPRKGSSFVRGRSGARGGASYNARGGSRGGRGGMGRNMNQRNTGRKGWRDWEKNNRNRESSVVISPQWTMLEEIDFIRLSKLKLDVDEPDDLDTYGRLFTYDKSYDRISTKSERPLQPTDRIKYNTTTSDDPVIQQYTSKNVATVYTTDAILSVLMCAPRSVYPWDIVIIREGNTLFFDKRDGGPFDTVTVNENAADPPQDSPAPNSNNPADKNVVHDPPSINSATSLSLEATYINQNFSFQTATETGPPPPIDLTHPNPFYGPEETEPLASCGYRYRLFDLSVTEEEDIRLCVRTEVDAFSAGSGNPREGQGLVTIRALNEFDTRAQGAGGAPDWRTKLDSQRGAVVATEMKNNSCKLAKWTVQSILAGAELMKIGSVSSIAQYRLLCHIFLNELTHTTHRYISRVNPRDNTRHVILSTASMRPTEFAAQLNVSLANGWGIVRTVTDLCMKMPEGKYVLVKDPNKPVIRLYAVPPGTFAVDEDEEVEAVEQEPEPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.19
4 0.14
5 0.14
6 0.16
7 0.17
8 0.13
9 0.17
10 0.19
11 0.22
12 0.25
13 0.28
14 0.27
15 0.27
16 0.3
17 0.26
18 0.34
19 0.32
20 0.36
21 0.38
22 0.42
23 0.42
24 0.47
25 0.5
26 0.43
27 0.49
28 0.49
29 0.46
30 0.46
31 0.48
32 0.43
33 0.43
34 0.41
35 0.42
36 0.38
37 0.35
38 0.32
39 0.31
40 0.29
41 0.28
42 0.3
43 0.21
44 0.2
45 0.2
46 0.19
47 0.17
48 0.18
49 0.19
50 0.17
51 0.17
52 0.2
53 0.22
54 0.22
55 0.23
56 0.22
57 0.2
58 0.21
59 0.23
60 0.27
61 0.35
62 0.42
63 0.44
64 0.47
65 0.46
66 0.49
67 0.48
68 0.47
69 0.39
70 0.34
71 0.33
72 0.29
73 0.29
74 0.25
75 0.23
76 0.17
77 0.16
78 0.12
79 0.09
80 0.09
81 0.11
82 0.11
83 0.1
84 0.1
85 0.1
86 0.1
87 0.14
88 0.15
89 0.12
90 0.12
91 0.12
92 0.17
93 0.17
94 0.21
95 0.2
96 0.21
97 0.3
98 0.38
99 0.41
100 0.4
101 0.44
102 0.46
103 0.52
104 0.53
105 0.54
106 0.56
107 0.56
108 0.58
109 0.56
110 0.52
111 0.48
112 0.46
113 0.38
114 0.3
115 0.28
116 0.22
117 0.24
118 0.25
119 0.21
120 0.2
121 0.19
122 0.18
123 0.18
124 0.19
125 0.17
126 0.18
127 0.19
128 0.18
129 0.18
130 0.19
131 0.23
132 0.27
133 0.27
134 0.28
135 0.35
136 0.39
137 0.39
138 0.45
139 0.45
140 0.47
141 0.48
142 0.52
143 0.51
144 0.52
145 0.56
146 0.58
147 0.64
148 0.65
149 0.68
150 0.72
151 0.75
152 0.77
153 0.81
154 0.78
155 0.72
156 0.64
157 0.59
158 0.52
159 0.45
160 0.41
161 0.34
162 0.28
163 0.26
164 0.25
165 0.23
166 0.18
167 0.15
168 0.12
169 0.09
170 0.09
171 0.09
172 0.09
173 0.1
174 0.1
175 0.09
176 0.1
177 0.11
178 0.11
179 0.13
180 0.15
181 0.15
182 0.16
183 0.17
184 0.19
185 0.2
186 0.22
187 0.2
188 0.18
189 0.17
190 0.16
191 0.14
192 0.11
193 0.09
194 0.07
195 0.06
196 0.06
197 0.06
198 0.08
199 0.14
200 0.18
201 0.18
202 0.21
203 0.23
204 0.26
205 0.28
206 0.28
207 0.26
208 0.29
209 0.33
210 0.39
211 0.46
212 0.46
213 0.49
214 0.55
215 0.54
216 0.57
217 0.6
218 0.55
219 0.53
220 0.53
221 0.49
222 0.45
223 0.44
224 0.39
225 0.35
226 0.34
227 0.28
228 0.28
229 0.26
230 0.23
231 0.23
232 0.19
233 0.15
234 0.15
235 0.14
236 0.15
237 0.17
238 0.16
239 0.14
240 0.13
241 0.14
242 0.13
243 0.14
244 0.13
245 0.11
246 0.11
247 0.1
248 0.1
249 0.09
250 0.08
251 0.07
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.06
258 0.07
259 0.09
260 0.1
261 0.1
262 0.11
263 0.11
264 0.13
265 0.12
266 0.12
267 0.12
268 0.1
269 0.1
270 0.1
271 0.1
272 0.09
273 0.09
274 0.11
275 0.09
276 0.09
277 0.09
278 0.1
279 0.11
280 0.14
281 0.15
282 0.15
283 0.16
284 0.16
285 0.17
286 0.16
287 0.15
288 0.13
289 0.11
290 0.1
291 0.08
292 0.09
293 0.07
294 0.07
295 0.07
296 0.06
297 0.06
298 0.08
299 0.08
300 0.08
301 0.11
302 0.18
303 0.21
304 0.21
305 0.24
306 0.25
307 0.28
308 0.29
309 0.28
310 0.24
311 0.2
312 0.24
313 0.26
314 0.25
315 0.22
316 0.23
317 0.22
318 0.2
319 0.23
320 0.18
321 0.14
322 0.12
323 0.12
324 0.1
325 0.1
326 0.1
327 0.07
328 0.07
329 0.07
330 0.07
331 0.07
332 0.1
333 0.09
334 0.1
335 0.09
336 0.1
337 0.1
338 0.11
339 0.1
340 0.07
341 0.1
342 0.1
343 0.11
344 0.14
345 0.15
346 0.15
347 0.17
348 0.17
349 0.15
350 0.13
351 0.14
352 0.14
353 0.18
354 0.23
355 0.27
356 0.28
357 0.28
358 0.28
359 0.28
360 0.27
361 0.24
362 0.2
363 0.14
364 0.17
365 0.17
366 0.18
367 0.17
368 0.15
369 0.13
370 0.11
371 0.1
372 0.1
373 0.14
374 0.16
375 0.17
376 0.19
377 0.21
378 0.22
379 0.23
380 0.22
381 0.23
382 0.21
383 0.21
384 0.18
385 0.16
386 0.15
387 0.14
388 0.13
389 0.09
390 0.09
391 0.08
392 0.08
393 0.08
394 0.1
395 0.1
396 0.11
397 0.11
398 0.12
399 0.11
400 0.11
401 0.11
402 0.1
403 0.12
404 0.11
405 0.11
406 0.1
407 0.11
408 0.11
409 0.11
410 0.11
411 0.12
412 0.14
413 0.14
414 0.15
415 0.15
416 0.14
417 0.15
418 0.14
419 0.12
420 0.11
421 0.11
422 0.11
423 0.13
424 0.13
425 0.12
426 0.11
427 0.11
428 0.09
429 0.09
430 0.1
431 0.09
432 0.09
433 0.12
434 0.13
435 0.13
436 0.15
437 0.17
438 0.24
439 0.32
440 0.36
441 0.35
442 0.39
443 0.39
444 0.37
445 0.34
446 0.27
447 0.22
448 0.18
449 0.2
450 0.16
451 0.17
452 0.2
453 0.2
454 0.22
455 0.21
456 0.21
457 0.23
458 0.31
459 0.34
460 0.35
461 0.39
462 0.39
463 0.39
464 0.38
465 0.32
466 0.24
467 0.19
468 0.15
469 0.11
470 0.08
471 0.06
472 0.05
473 0.05
474 0.04
475 0.04
476 0.04
477 0.05
478 0.04
479 0.07
480 0.1
481 0.1
482 0.13
483 0.14
484 0.16
485 0.21
486 0.22
487 0.2
488 0.17
489 0.19
490 0.18
491 0.19
492 0.2
493 0.15
494 0.16
495 0.18
496 0.19
497 0.2
498 0.2
499 0.24
500 0.23
501 0.25
502 0.28
503 0.35
504 0.44
505 0.5
506 0.55
507 0.58
508 0.63
509 0.68
510 0.69
511 0.66
512 0.59
513 0.54
514 0.47
515 0.42
516 0.36
517 0.33
518 0.31
519 0.27
520 0.25
521 0.21
522 0.21
523 0.19
524 0.21
525 0.19
526 0.17
527 0.16
528 0.18
529 0.19
530 0.19
531 0.19
532 0.16
533 0.13
534 0.12
535 0.1
536 0.07
537 0.07
538 0.07
539 0.06
540 0.06
541 0.06
542 0.06
543 0.09
544 0.09
545 0.11
546 0.15
547 0.16
548 0.16
549 0.19
550 0.2
551 0.26
552 0.26
553 0.29
554 0.28
555 0.3
556 0.34
557 0.35
558 0.4
559 0.42
560 0.44
561 0.45
562 0.52
563 0.59
564 0.57
565 0.55
566 0.5
567 0.49
568 0.5
569 0.47
570 0.41
571 0.42
572 0.4
573 0.39
574 0.37
575 0.31
576 0.27
577 0.24
578 0.21
579 0.16
580 0.16
581 0.16
582 0.16
583 0.16
584 0.14
585 0.14
586 0.14
587 0.09
588 0.08
589 0.1
590 0.08