Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NVF3

Protein Details
Accession A0A2A9NVF3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-66YTIVPSPQRPLRKKRRERRRPKPKLHIPPSQSBasic
NLS Segment(s)
PositionSequence
43-59RPLRKKRRERRRPKPKL
Subcellular Location(s) extr 14, golg 5, plas 4, vacu 2
Family & Domain DBs
Amino Acid Sequences MGYARLIIIIATSLTLAQSILLDQLWGPSLNLGSYTIVPSPQRPLRKKRRERRRPKPKLHIPPSQSNIARADAFALELGLGHPPRSEDDDKTIDWQAHSVESTLLCSHDAGNSFDIEGHYDYSPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.09
24 0.11
25 0.12
26 0.13
27 0.19
28 0.23
29 0.32
30 0.38
31 0.48
32 0.58
33 0.68
34 0.78
35 0.82
36 0.87
37 0.89
38 0.93
39 0.94
40 0.95
41 0.94
42 0.94
43 0.94
44 0.93
45 0.93
46 0.89
47 0.85
48 0.79
49 0.75
50 0.68
51 0.63
52 0.53
53 0.44
54 0.39
55 0.32
56 0.27
57 0.19
58 0.17
59 0.1
60 0.1
61 0.08
62 0.06
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.1
72 0.16
73 0.18
74 0.18
75 0.23
76 0.26
77 0.27
78 0.29
79 0.3
80 0.25
81 0.22
82 0.21
83 0.16
84 0.15
85 0.15
86 0.12
87 0.11
88 0.1
89 0.12
90 0.12
91 0.11
92 0.11
93 0.11
94 0.11
95 0.12
96 0.14
97 0.14
98 0.15
99 0.15
100 0.15
101 0.15
102 0.15
103 0.15
104 0.14
105 0.15