Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NQH3

Protein Details
Accession A0A2A9NQH3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
295-321TITPPSTPRKPKSSPTRRSTSPRKSALHydrophilic
NLS Segment(s)
PositionSequence
277-337KKEIKPEPAEEKKVKLRPTITPPSTPRKPKSSPTRRSTSPRKSALPPTPEKARITAFFRKK
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MCGRFALRLDRHQIRNAIPDADEWLDEDAFMPRYNIAPRTYSPVIRRPAPALAPIEDRLVLHTMKWGLVPHWSKVEDKTLSTTNARAENLVNGGGMWSNIKGKNRCAVVCQGYYEWLTKGKVKLPHFTKMKDGNLMLLAGLYDHAVINGQSLWTFSIVTTDANPDFAWLHDRQPVILSTPESLNAWLDTSTPGWTPTLTKLVQPYKDTGHPLECYQVPKEVGKVGTESPSFIEPIKDRKDGIQAMFQKQLQSTSGSGGGTKRKHDSSPTEESKDDSKKEIKPEPAEEKKVKLRPTITPPSTPRKPKSSPTRRSTSPRKSALPPTPEKARITAFFRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.53
4 0.47
5 0.39
6 0.35
7 0.33
8 0.29
9 0.25
10 0.18
11 0.18
12 0.15
13 0.14
14 0.14
15 0.13
16 0.13
17 0.13
18 0.13
19 0.11
20 0.15
21 0.19
22 0.22
23 0.22
24 0.24
25 0.25
26 0.33
27 0.36
28 0.39
29 0.41
30 0.45
31 0.48
32 0.48
33 0.5
34 0.44
35 0.46
36 0.41
37 0.41
38 0.36
39 0.33
40 0.33
41 0.31
42 0.29
43 0.25
44 0.23
45 0.2
46 0.19
47 0.16
48 0.13
49 0.16
50 0.15
51 0.15
52 0.17
53 0.15
54 0.13
55 0.22
56 0.25
57 0.23
58 0.27
59 0.28
60 0.29
61 0.3
62 0.37
63 0.3
64 0.29
65 0.31
66 0.29
67 0.3
68 0.3
69 0.3
70 0.26
71 0.28
72 0.27
73 0.24
74 0.22
75 0.2
76 0.2
77 0.18
78 0.13
79 0.09
80 0.09
81 0.08
82 0.08
83 0.06
84 0.06
85 0.11
86 0.14
87 0.21
88 0.23
89 0.26
90 0.31
91 0.34
92 0.34
93 0.33
94 0.36
95 0.34
96 0.33
97 0.32
98 0.27
99 0.25
100 0.26
101 0.23
102 0.17
103 0.15
104 0.15
105 0.17
106 0.19
107 0.23
108 0.29
109 0.31
110 0.39
111 0.4
112 0.48
113 0.48
114 0.48
115 0.5
116 0.49
117 0.48
118 0.43
119 0.39
120 0.31
121 0.28
122 0.26
123 0.18
124 0.11
125 0.09
126 0.05
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.05
142 0.04
143 0.06
144 0.06
145 0.06
146 0.07
147 0.08
148 0.08
149 0.09
150 0.09
151 0.08
152 0.08
153 0.08
154 0.11
155 0.1
156 0.11
157 0.14
158 0.14
159 0.14
160 0.15
161 0.15
162 0.13
163 0.13
164 0.13
165 0.1
166 0.1
167 0.11
168 0.1
169 0.1
170 0.08
171 0.07
172 0.07
173 0.06
174 0.06
175 0.07
176 0.07
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.09
183 0.1
184 0.15
185 0.14
186 0.15
187 0.21
188 0.27
189 0.3
190 0.3
191 0.3
192 0.28
193 0.31
194 0.32
195 0.28
196 0.26
197 0.24
198 0.23
199 0.24
200 0.23
201 0.22
202 0.2
203 0.22
204 0.2
205 0.19
206 0.2
207 0.2
208 0.18
209 0.17
210 0.18
211 0.15
212 0.18
213 0.18
214 0.17
215 0.15
216 0.15
217 0.15
218 0.14
219 0.16
220 0.14
221 0.22
222 0.27
223 0.27
224 0.27
225 0.28
226 0.35
227 0.35
228 0.35
229 0.35
230 0.36
231 0.38
232 0.42
233 0.4
234 0.35
235 0.32
236 0.31
237 0.24
238 0.21
239 0.18
240 0.16
241 0.17
242 0.15
243 0.16
244 0.18
245 0.24
246 0.24
247 0.27
248 0.3
249 0.32
250 0.34
251 0.39
252 0.44
253 0.44
254 0.52
255 0.54
256 0.53
257 0.5
258 0.5
259 0.51
260 0.5
261 0.44
262 0.4
263 0.4
264 0.41
265 0.49
266 0.54
267 0.54
268 0.54
269 0.6
270 0.64
271 0.66
272 0.7
273 0.65
274 0.65
275 0.66
276 0.66
277 0.63
278 0.59
279 0.55
280 0.55
281 0.61
282 0.65
283 0.6
284 0.62
285 0.64
286 0.67
287 0.72
288 0.74
289 0.71
290 0.69
291 0.71
292 0.73
293 0.78
294 0.79
295 0.8
296 0.79
297 0.81
298 0.79
299 0.83
300 0.84
301 0.84
302 0.82
303 0.8
304 0.77
305 0.76
306 0.78
307 0.77
308 0.76
309 0.72
310 0.68
311 0.7
312 0.69
313 0.64
314 0.58
315 0.55
316 0.51
317 0.52