Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9P1K7

Protein Details
Accession A0A2A9P1K7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-32LLAVPKKKTSHSKKAMRSANKSHydrophilic
NLS Segment(s)
PositionSequence
17-24KKTSHSKK
Subcellular Location(s) mito 14, nucl 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLLDMFPPFLLAVPKKKTSHSKKAMRSANKSLKDKQNIVNCPACGSPKLAHNLCSNCYTYLNRTWKSQNKGAGGNAIPDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.37
4 0.44
5 0.53
6 0.57
7 0.64
8 0.67
9 0.71
10 0.73
11 0.8
12 0.83
13 0.81
14 0.78
15 0.78
16 0.77
17 0.75
18 0.71
19 0.68
20 0.68
21 0.65
22 0.62
23 0.58
24 0.57
25 0.52
26 0.52
27 0.48
28 0.39
29 0.35
30 0.32
31 0.26
32 0.18
33 0.18
34 0.16
35 0.17
36 0.23
37 0.22
38 0.25
39 0.3
40 0.31
41 0.31
42 0.32
43 0.29
44 0.24
45 0.26
46 0.25
47 0.24
48 0.31
49 0.37
50 0.36
51 0.39
52 0.47
53 0.53
54 0.58
55 0.6
56 0.58
57 0.55
58 0.57
59 0.54
60 0.51
61 0.44
62 0.39