Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P1B4

Protein Details
Accession A0A2A9P1B4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-87GTTIIKENKKRAQRARLRAAHydrophilic
NLS Segment(s)
PositionSequence
76-85KKRAQRARLR
Subcellular Location(s) plas 21, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
IPR013717  PIG-P  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
PF08510  PIG-P  
Amino Acid Sequences ALSDKALGSAMLLVASVIFVYYTVWAILLPFIDSSSIVHSYFPQREWAVRIPAFLLVIGLSAIGAFIGTTIIKENKKRAQRARLRAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.08
23 0.09
24 0.09
25 0.09
26 0.1
27 0.15
28 0.16
29 0.16
30 0.17
31 0.16
32 0.16
33 0.2
34 0.22
35 0.23
36 0.22
37 0.21
38 0.19
39 0.19
40 0.18
41 0.14
42 0.11
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.04
57 0.07
58 0.13
59 0.18
60 0.23
61 0.31
62 0.39
63 0.49
64 0.58
65 0.65
66 0.71
67 0.77