Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q872F4

Protein Details
Accession Q872F4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
135-161ALESNKESIKKEKKKPRKSNIDVTSDEHydrophilic
NLS Segment(s)
PositionSequence
140-152KESIKKEKKKPRK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
KEGG ncr:NCU04584  -  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MPPKRRQAEDTSDAEPQYTKKSKGNTGKAQPQELTKGSDQDGNTFWELGNNRRISSSVFRNTTLVNIREYYDAGGKLMPGKKGISLSLAQYQNLLKVIPQLNADLRAQGHAIEDPGFAQVAEQTDAPIETPKVKALESNKESIKKEKKKPRKSNIDVTSDEEEAAEDEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.27
4 0.29
5 0.31
6 0.31
7 0.33
8 0.39
9 0.48
10 0.57
11 0.65
12 0.66
13 0.69
14 0.75
15 0.74
16 0.72
17 0.64
18 0.57
19 0.53
20 0.45
21 0.4
22 0.32
23 0.3
24 0.27
25 0.3
26 0.27
27 0.24
28 0.24
29 0.22
30 0.21
31 0.19
32 0.17
33 0.17
34 0.19
35 0.2
36 0.26
37 0.24
38 0.24
39 0.24
40 0.25
41 0.24
42 0.28
43 0.32
44 0.32
45 0.33
46 0.33
47 0.34
48 0.33
49 0.33
50 0.33
51 0.26
52 0.2
53 0.19
54 0.19
55 0.19
56 0.19
57 0.16
58 0.13
59 0.12
60 0.1
61 0.1
62 0.08
63 0.12
64 0.15
65 0.14
66 0.13
67 0.13
68 0.14
69 0.15
70 0.15
71 0.13
72 0.11
73 0.12
74 0.18
75 0.18
76 0.17
77 0.17
78 0.17
79 0.16
80 0.15
81 0.13
82 0.07
83 0.11
84 0.13
85 0.13
86 0.14
87 0.15
88 0.15
89 0.18
90 0.18
91 0.14
92 0.12
93 0.11
94 0.11
95 0.1
96 0.1
97 0.08
98 0.08
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.1
117 0.11
118 0.14
119 0.15
120 0.15
121 0.19
122 0.23
123 0.33
124 0.34
125 0.39
126 0.42
127 0.47
128 0.49
129 0.54
130 0.6
131 0.59
132 0.67
133 0.72
134 0.78
135 0.83
136 0.92
137 0.93
138 0.93
139 0.92
140 0.92
141 0.89
142 0.85
143 0.77
144 0.71
145 0.64
146 0.53
147 0.45
148 0.34
149 0.25
150 0.19
151 0.17
152 0.12