Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NG37

Protein Details
Accession A0A2A9NG37    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-86QAYRDCKKAWIEKRKEDRRNGRRBasic
NLS Segment(s)
PositionSequence
75-86EKRKEDRRNGRR
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MTKDAKDSLPPPQDNVKPLDYKEQFEGRQVASQFIDPCAAASKASMDCLNRNNYDRDACLDYFQAYRDCKKAWIEKRKEDRRNGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.43
4 0.37
5 0.38
6 0.44
7 0.38
8 0.37
9 0.39
10 0.4
11 0.36
12 0.36
13 0.37
14 0.28
15 0.3
16 0.28
17 0.25
18 0.2
19 0.21
20 0.19
21 0.16
22 0.16
23 0.11
24 0.11
25 0.11
26 0.1
27 0.08
28 0.07
29 0.09
30 0.08
31 0.09
32 0.1
33 0.09
34 0.12
35 0.16
36 0.2
37 0.2
38 0.23
39 0.24
40 0.25
41 0.26
42 0.24
43 0.24
44 0.24
45 0.22
46 0.21
47 0.2
48 0.19
49 0.18
50 0.19
51 0.2
52 0.19
53 0.22
54 0.24
55 0.24
56 0.27
57 0.33
58 0.42
59 0.47
60 0.56
61 0.61
62 0.69
63 0.79
64 0.85
65 0.88
66 0.89