Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9N867

Protein Details
Accession A0A2A9N867    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-57DGPNSMGKKKKRERKGKERKGTIDGHBasic
NLS Segment(s)
PositionSequence
38-51GKKKKRERKGKERK
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGHNDTVYSTCATATATILHPSVRNLVHLTDDGPNSMGKKKKRERKGKERKGTIDGHGDAILVRYGGVGFFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.12
6 0.13
7 0.13
8 0.13
9 0.17
10 0.15
11 0.15
12 0.14
13 0.14
14 0.15
15 0.15
16 0.15
17 0.14
18 0.14
19 0.12
20 0.12
21 0.11
22 0.11
23 0.16
24 0.2
25 0.21
26 0.32
27 0.41
28 0.5
29 0.6
30 0.7
31 0.76
32 0.82
33 0.89
34 0.9
35 0.91
36 0.9
37 0.85
38 0.8
39 0.74
40 0.66
41 0.62
42 0.52
43 0.43
44 0.35
45 0.29
46 0.23
47 0.2
48 0.16
49 0.08
50 0.07
51 0.06
52 0.06