Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K4R2

Protein Details
Accession Q1K4R2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPQGPRRNDPLPTBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPQGPRR
Subcellular Location(s) mito 14, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG ncr:NCU01447  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPRRNDPLPTVFTCLFCNHERSVIVKLDKKAGVGYLDCKICGQKFQCPVNYLDAAVDVYSAWVDAADAVAQEAEASAKAASYSNSRSTGGRPAASSRRAADIDEDDEDDDRGYGGSGVEVDDDDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.87
4 0.79
5 0.73
6 0.68
7 0.62
8 0.54
9 0.51
10 0.44
11 0.36
12 0.35
13 0.31
14 0.29
15 0.26
16 0.27
17 0.22
18 0.23
19 0.23
20 0.23
21 0.26
22 0.27
23 0.3
24 0.31
25 0.32
26 0.35
27 0.34
28 0.33
29 0.29
30 0.24
31 0.21
32 0.17
33 0.18
34 0.17
35 0.17
36 0.16
37 0.16
38 0.17
39 0.15
40 0.2
41 0.19
42 0.21
43 0.28
44 0.32
45 0.34
46 0.35
47 0.36
48 0.34
49 0.33
50 0.26
51 0.19
52 0.15
53 0.12
54 0.1
55 0.08
56 0.04
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.02
70 0.02
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.06
80 0.09
81 0.13
82 0.16
83 0.18
84 0.19
85 0.2
86 0.22
87 0.29
88 0.29
89 0.27
90 0.24
91 0.29
92 0.34
93 0.36
94 0.37
95 0.31
96 0.32
97 0.31
98 0.31
99 0.28
100 0.25
101 0.25
102 0.24
103 0.23
104 0.19
105 0.19
106 0.18
107 0.15
108 0.11
109 0.09
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07