Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NEH4

Protein Details
Accession A0A2A9NEH4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-105IEEKRRRNTLSARKSRQRRIQHLQELERQRHydrophilic
NLS Segment(s)
PositionSequence
79-91KRRRNTLSARKSR
Subcellular Location(s) nucl 20, cyto_nucl 16.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences IVPSIPRPTLSLDAPIQPRTYLSPSNTSRKDIPKYFARKAHSQGSIFPDPYCEDEKDELLEENITTTLDSKLKHQIEEKRRRNTLSARKSRQRRIQHLQELERQRDDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.31
4 0.27
5 0.27
6 0.25
7 0.28
8 0.26
9 0.26
10 0.33
11 0.37
12 0.46
13 0.47
14 0.47
15 0.49
16 0.51
17 0.55
18 0.5
19 0.51
20 0.5
21 0.56
22 0.58
23 0.58
24 0.56
25 0.54
26 0.54
27 0.56
28 0.51
29 0.44
30 0.42
31 0.43
32 0.41
33 0.36
34 0.31
35 0.25
36 0.21
37 0.23
38 0.22
39 0.16
40 0.15
41 0.15
42 0.16
43 0.15
44 0.15
45 0.12
46 0.09
47 0.09
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.09
56 0.1
57 0.12
58 0.21
59 0.22
60 0.25
61 0.3
62 0.38
63 0.47
64 0.58
65 0.64
66 0.64
67 0.67
68 0.68
69 0.67
70 0.68
71 0.68
72 0.68
73 0.7
74 0.7
75 0.76
76 0.83
77 0.87
78 0.87
79 0.87
80 0.86
81 0.85
82 0.86
83 0.86
84 0.86
85 0.82
86 0.81
87 0.79
88 0.75
89 0.67