Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9P1D1

Protein Details
Accession A0A2A9P1D1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
148-180SMQLPRCTRNPTQRRKKVKRRRSRARKFLLPVPHydrophilic
NLS Segment(s)
PositionSequence
160-174QRRKKVKRRRSRARK
Subcellular Location(s) nucl 7, cyto 7, extr 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038887  Nus1/NgBR  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:1904423  C:dehydrodolichyl diphosphate synthase complex  
GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
Amino Acid Sequences MSCLSSVFLFLFHQFYSLCLSLHSYSRLLMWRQPALLDAPRKRIPNHLALLLVSDSSQPSEHAQDCMLQSVQRAVGWSQQVGIRKLTVYDQHGILIRCIPQIRERLASLVPTVESSDSEIEYPLTPPSSDYADSRPLSPRAVYPHVFSMQLPRCTRNPTQRRKKVKRRRSRARKFLLPVPFRHFNHVFPFADAGNVALAPLTLCISSRDSAKPAVATAACSLLQAGKSDQLFNPQQPTSPPVSVDTLNVLLECTFLLLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.19
4 0.18
5 0.16
6 0.15
7 0.19
8 0.2
9 0.23
10 0.25
11 0.19
12 0.19
13 0.22
14 0.27
15 0.25
16 0.28
17 0.3
18 0.3
19 0.3
20 0.3
21 0.28
22 0.27
23 0.31
24 0.36
25 0.35
26 0.4
27 0.44
28 0.47
29 0.48
30 0.52
31 0.51
32 0.5
33 0.49
34 0.43
35 0.39
36 0.35
37 0.36
38 0.27
39 0.22
40 0.13
41 0.11
42 0.09
43 0.09
44 0.09
45 0.08
46 0.1
47 0.15
48 0.16
49 0.16
50 0.16
51 0.18
52 0.18
53 0.2
54 0.18
55 0.14
56 0.13
57 0.15
58 0.15
59 0.12
60 0.13
61 0.11
62 0.15
63 0.16
64 0.15
65 0.14
66 0.16
67 0.2
68 0.21
69 0.21
70 0.17
71 0.16
72 0.17
73 0.18
74 0.19
75 0.18
76 0.19
77 0.18
78 0.19
79 0.22
80 0.22
81 0.2
82 0.17
83 0.15
84 0.15
85 0.16
86 0.15
87 0.16
88 0.2
89 0.22
90 0.23
91 0.22
92 0.22
93 0.22
94 0.21
95 0.17
96 0.13
97 0.11
98 0.09
99 0.09
100 0.07
101 0.07
102 0.07
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.08
110 0.07
111 0.07
112 0.06
113 0.07
114 0.08
115 0.09
116 0.09
117 0.1
118 0.12
119 0.18
120 0.18
121 0.19
122 0.21
123 0.2
124 0.21
125 0.2
126 0.2
127 0.19
128 0.23
129 0.23
130 0.21
131 0.23
132 0.23
133 0.23
134 0.21
135 0.25
136 0.26
137 0.32
138 0.32
139 0.32
140 0.33
141 0.38
142 0.44
143 0.46
144 0.5
145 0.54
146 0.64
147 0.72
148 0.81
149 0.86
150 0.92
151 0.92
152 0.93
153 0.93
154 0.93
155 0.95
156 0.95
157 0.95
158 0.94
159 0.92
160 0.9
161 0.83
162 0.79
163 0.78
164 0.71
165 0.64
166 0.61
167 0.6
168 0.52
169 0.55
170 0.49
171 0.42
172 0.44
173 0.45
174 0.38
175 0.31
176 0.31
177 0.24
178 0.22
179 0.19
180 0.14
181 0.08
182 0.07
183 0.06
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.07
192 0.1
193 0.12
194 0.15
195 0.17
196 0.19
197 0.21
198 0.22
199 0.2
200 0.18
201 0.22
202 0.18
203 0.18
204 0.17
205 0.17
206 0.15
207 0.15
208 0.14
209 0.12
210 0.13
211 0.13
212 0.13
213 0.16
214 0.17
215 0.2
216 0.2
217 0.26
218 0.29
219 0.3
220 0.35
221 0.31
222 0.32
223 0.31
224 0.36
225 0.34
226 0.32
227 0.3
228 0.27
229 0.3
230 0.29
231 0.27
232 0.26
233 0.21
234 0.2
235 0.18
236 0.16
237 0.12
238 0.12
239 0.1