Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NE97

Protein Details
Accession A0A2A9NE97    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRAHHARRDVHRATRBasic
74-99ALNTHWKSKIHKRRCKQLREPAYTIEHydrophilic
NLS Segment(s)
PositionSequence
6-19RSRAHHARRDVHRA
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRAHHARRDVHRATRTRARAKDLDQIQLIDLDPKNRAALEAQALDFEKPGLAQHYCVECARYFETDSALNTHWKSKIHKRRCKQLREPAYTIEESERAAGLGREGKRPSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.78
4 0.76
5 0.72
6 0.69
7 0.69
8 0.7
9 0.7
10 0.68
11 0.66
12 0.63
13 0.61
14 0.62
15 0.56
16 0.52
17 0.44
18 0.4
19 0.33
20 0.28
21 0.24
22 0.2
23 0.18
24 0.14
25 0.14
26 0.14
27 0.14
28 0.13
29 0.14
30 0.1
31 0.11
32 0.12
33 0.12
34 0.12
35 0.12
36 0.13
37 0.12
38 0.11
39 0.09
40 0.06
41 0.05
42 0.05
43 0.07
44 0.06
45 0.07
46 0.1
47 0.11
48 0.12
49 0.12
50 0.14
51 0.12
52 0.14
53 0.15
54 0.14
55 0.14
56 0.13
57 0.14
58 0.14
59 0.14
60 0.14
61 0.14
62 0.16
63 0.15
64 0.18
65 0.19
66 0.21
67 0.27
68 0.36
69 0.46
70 0.54
71 0.63
72 0.68
73 0.77
74 0.84
75 0.88
76 0.87
77 0.87
78 0.87
79 0.85
80 0.8
81 0.74
82 0.69
83 0.59
84 0.5
85 0.42
86 0.32
87 0.24
88 0.22
89 0.17
90 0.12
91 0.12
92 0.11
93 0.11
94 0.18
95 0.19
96 0.25
97 0.27