Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NPP2

Protein Details
Accession A0A2A9NPP2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-72CCRCFGSSRRTGRRQYRFGRRRRAAVYHydrophilic
NLS Segment(s)
PositionSequence
62-67RFGRRR
Subcellular Location(s) plas 16, vacu 6, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAIFSAIGAGINAVISAIANVFLAIVDAVTAVVVTIFDVIFDILCCRCFGSSRRTGRRQYRFGRRRRAAVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.1
37 0.14
38 0.21
39 0.3
40 0.4
41 0.49
42 0.56
43 0.65
44 0.73
45 0.8
46 0.81
47 0.82
48 0.83
49 0.83
50 0.86
51 0.88
52 0.84