Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NH30

Protein Details
Accession A0A2A9NH30   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-121SYSEQPPRSNKPQKPPSKIGKYFNCFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 6, E.R. 4, golg 4, vacu 2
Family & Domain DBs
Amino Acid Sequences MYRMHFPTILLFTAAFLISSVTAMPMAKMPHPRAIMPFTNGYNVARGSPVLQGHKLATRQTSKGLRSLVSDSRQQSTGGMSSYSSFCEKNMGSCISYSEQPPRSNKPQKPPSKIGKYFNCFGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.05
9 0.06
10 0.06
11 0.06
12 0.08
13 0.1
14 0.14
15 0.21
16 0.23
17 0.29
18 0.31
19 0.31
20 0.32
21 0.36
22 0.35
23 0.31
24 0.31
25 0.25
26 0.25
27 0.25
28 0.22
29 0.18
30 0.16
31 0.13
32 0.11
33 0.1
34 0.09
35 0.11
36 0.13
37 0.14
38 0.14
39 0.15
40 0.15
41 0.18
42 0.18
43 0.17
44 0.19
45 0.2
46 0.2
47 0.24
48 0.28
49 0.26
50 0.28
51 0.28
52 0.24
53 0.24
54 0.27
55 0.26
56 0.24
57 0.27
58 0.25
59 0.26
60 0.26
61 0.24
62 0.21
63 0.18
64 0.16
65 0.12
66 0.11
67 0.09
68 0.1
69 0.1
70 0.12
71 0.12
72 0.11
73 0.1
74 0.14
75 0.14
76 0.15
77 0.19
78 0.2
79 0.18
80 0.19
81 0.22
82 0.2
83 0.22
84 0.22
85 0.26
86 0.3
87 0.34
88 0.4
89 0.45
90 0.53
91 0.62
92 0.67
93 0.69
94 0.74
95 0.79
96 0.83
97 0.84
98 0.84
99 0.85
100 0.85
101 0.84
102 0.84
103 0.8