Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S4E7

Protein Details
Accession Q7S4E7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-109AIKKRCEHCKVVRRKANKRQNGYLYIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU06038  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MSNLFRSLASSMRALSLAAPRATAVNTTKTVVSTHQTRCLSQGLLSRHICTPMCSHNRPVAVCQSAKNGLQSKQQSRGMKVHSAIKKRCEHCKVVRRKANKRQNGYLYIICPANPRHKQRQGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.2
5 0.19
6 0.18
7 0.17
8 0.18
9 0.18
10 0.19
11 0.17
12 0.17
13 0.18
14 0.19
15 0.19
16 0.19
17 0.2
18 0.18
19 0.2
20 0.23
21 0.25
22 0.32
23 0.33
24 0.33
25 0.34
26 0.34
27 0.3
28 0.26
29 0.28
30 0.23
31 0.29
32 0.3
33 0.29
34 0.27
35 0.29
36 0.27
37 0.22
38 0.21
39 0.23
40 0.29
41 0.29
42 0.31
43 0.32
44 0.35
45 0.33
46 0.32
47 0.28
48 0.25
49 0.23
50 0.22
51 0.21
52 0.21
53 0.21
54 0.23
55 0.22
56 0.21
57 0.27
58 0.32
59 0.33
60 0.38
61 0.44
62 0.43
63 0.44
64 0.47
65 0.44
66 0.42
67 0.4
68 0.41
69 0.42
70 0.48
71 0.48
72 0.51
73 0.56
74 0.56
75 0.64
76 0.61
77 0.62
78 0.64
79 0.7
80 0.73
81 0.75
82 0.79
83 0.8
84 0.84
85 0.87
86 0.88
87 0.88
88 0.85
89 0.83
90 0.82
91 0.77
92 0.72
93 0.65
94 0.55
95 0.49
96 0.41
97 0.33
98 0.3
99 0.29
100 0.34
101 0.39
102 0.46
103 0.54
104 0.62