Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NBA6

Protein Details
Accession A0A2A9NBA6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-166RPAPSDSKANQQQNKRRKGSHydrophilic
NLS Segment(s)
PositionSequence
138-172PKLRSSAPKRPAPSDSKANQQQNKRRKGSPSGLRR
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MARDILRQRPHKCEHDLESFIWVLFWLVLRHMDYFKTVWTCSRLFDEPDPLKAAYAKNGFLTDQVADKIYVRVRHNRPLNTLLQELVRRVLDVLPLSHLNVLPLFESALRRLHWPENDTAKRFTVEEKSDFATGSSRPKLRSSAPKRPAPSDSKANQQQNKRRKGSPSGLRRVAQTQSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.61
4 0.53
5 0.49
6 0.42
7 0.35
8 0.27
9 0.21
10 0.13
11 0.1
12 0.1
13 0.07
14 0.08
15 0.1
16 0.12
17 0.14
18 0.14
19 0.15
20 0.15
21 0.15
22 0.18
23 0.19
24 0.18
25 0.2
26 0.23
27 0.23
28 0.22
29 0.27
30 0.26
31 0.26
32 0.28
33 0.34
34 0.31
35 0.33
36 0.34
37 0.29
38 0.27
39 0.26
40 0.24
41 0.21
42 0.22
43 0.2
44 0.18
45 0.19
46 0.19
47 0.17
48 0.18
49 0.12
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.12
56 0.14
57 0.19
58 0.21
59 0.3
60 0.33
61 0.42
62 0.47
63 0.47
64 0.48
65 0.47
66 0.47
67 0.41
68 0.37
69 0.29
70 0.25
71 0.23
72 0.19
73 0.16
74 0.13
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.08
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.11
96 0.11
97 0.13
98 0.16
99 0.2
100 0.22
101 0.24
102 0.28
103 0.36
104 0.4
105 0.41
106 0.4
107 0.37
108 0.35
109 0.33
110 0.3
111 0.27
112 0.26
113 0.26
114 0.26
115 0.27
116 0.27
117 0.26
118 0.23
119 0.18
120 0.16
121 0.21
122 0.25
123 0.25
124 0.27
125 0.29
126 0.33
127 0.38
128 0.47
129 0.5
130 0.55
131 0.61
132 0.66
133 0.68
134 0.69
135 0.69
136 0.64
137 0.61
138 0.6
139 0.55
140 0.57
141 0.62
142 0.67
143 0.67
144 0.71
145 0.75
146 0.75
147 0.82
148 0.78
149 0.75
150 0.73
151 0.75
152 0.75
153 0.75
154 0.76
155 0.76
156 0.77
157 0.73
158 0.69
159 0.64
160 0.61