Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P0B6

Protein Details
Accession A0A2A9P0B6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
146-169IAALKKSQRKTSIRKEEEKREAERHydrophilic
171-190TWSERKQLVRQIRAKRRELWHydrophilic
NLS Segment(s)
PositionSequence
153-166QRKTSIRKEEEKRE
183-186RAKR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MNAKKRILDASCLIRSYATKYPRPRPGTAERPPVHRPDPLTNNPNAITTSLENESLTFIHRPPPSSPSPYSLTTAPSSPLLWPKATPIDEPLPPISRPRLNKVPPQRASDEVLAEIRRLRLSDPTTYTRTKLAKMFGCTQTFIGSIAALKKSQRKTSIRKEEEKREAERVTWSERKQLVRQIRAKRRELW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.32
4 0.34
5 0.33
6 0.37
7 0.45
8 0.54
9 0.63
10 0.68
11 0.66
12 0.66
13 0.68
14 0.7
15 0.7
16 0.72
17 0.64
18 0.65
19 0.65
20 0.64
21 0.57
22 0.51
23 0.48
24 0.46
25 0.52
26 0.54
27 0.55
28 0.5
29 0.5
30 0.47
31 0.43
32 0.34
33 0.26
34 0.2
35 0.16
36 0.18
37 0.15
38 0.15
39 0.14
40 0.14
41 0.14
42 0.11
43 0.13
44 0.1
45 0.1
46 0.16
47 0.18
48 0.21
49 0.22
50 0.27
51 0.29
52 0.34
53 0.35
54 0.32
55 0.35
56 0.33
57 0.33
58 0.29
59 0.27
60 0.22
61 0.21
62 0.18
63 0.15
64 0.14
65 0.13
66 0.17
67 0.16
68 0.15
69 0.15
70 0.16
71 0.2
72 0.2
73 0.19
74 0.18
75 0.2
76 0.19
77 0.21
78 0.21
79 0.19
80 0.18
81 0.19
82 0.19
83 0.21
84 0.23
85 0.28
86 0.35
87 0.36
88 0.44
89 0.52
90 0.59
91 0.58
92 0.6
93 0.56
94 0.5
95 0.5
96 0.43
97 0.34
98 0.24
99 0.22
100 0.18
101 0.16
102 0.14
103 0.12
104 0.11
105 0.11
106 0.11
107 0.15
108 0.17
109 0.21
110 0.25
111 0.29
112 0.33
113 0.34
114 0.34
115 0.34
116 0.34
117 0.32
118 0.31
119 0.32
120 0.33
121 0.36
122 0.42
123 0.41
124 0.41
125 0.39
126 0.36
127 0.31
128 0.27
129 0.23
130 0.16
131 0.1
132 0.1
133 0.12
134 0.13
135 0.13
136 0.16
137 0.23
138 0.29
139 0.36
140 0.44
141 0.5
142 0.58
143 0.68
144 0.76
145 0.77
146 0.81
147 0.82
148 0.84
149 0.85
150 0.81
151 0.75
152 0.7
153 0.63
154 0.55
155 0.54
156 0.47
157 0.46
158 0.47
159 0.44
160 0.46
161 0.5
162 0.55
163 0.53
164 0.59
165 0.61
166 0.63
167 0.7
168 0.72
169 0.77
170 0.8