Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7UVY7

Protein Details
Accession A7UVY7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
139-161NVHPPPCTKKNVKKQRRTIETETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 8, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022190  DUF3716  
KEGG ncr:NCU11200  -  
Pfam View protein in Pfam  
PF12511  DUF3716  
Amino Acid Sequences MSATAPKIITIGYAHEALDRFVEQKVNKIGRNLEILRKEPPVRNINLRKDIGSVNLAVGGNLEAVFVQLNGKQATAECDVCKKSLGPFVGCVQHPSVGDGSCANCLYRRQGLKCTHRVSMDIDSDDLPLIQSRKTQDPNVHPPPCTKKNVKKQRRTIETETASHTEAEPPIHGPGTALGSAADHWLKSLAFSKYASPAPTQGEKANNDYAPNPGHFENGNYTSSSGLLENNNYTLSQAPAVMGGNDYAPSPMPFKGTMNDILDHDASKPMLAYLPKNVSPEVLRSIAQYHQDLADDLRMEAKRLEKEMRQEREREREREWGARAVRQAQYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.17
5 0.18
6 0.16
7 0.14
8 0.15
9 0.22
10 0.19
11 0.26
12 0.35
13 0.4
14 0.41
15 0.45
16 0.47
17 0.44
18 0.52
19 0.49
20 0.47
21 0.47
22 0.46
23 0.46
24 0.48
25 0.5
26 0.47
27 0.52
28 0.51
29 0.51
30 0.59
31 0.65
32 0.67
33 0.7
34 0.66
35 0.59
36 0.54
37 0.5
38 0.42
39 0.35
40 0.26
41 0.17
42 0.2
43 0.18
44 0.15
45 0.14
46 0.11
47 0.1
48 0.09
49 0.09
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.11
57 0.11
58 0.11
59 0.11
60 0.12
61 0.16
62 0.18
63 0.19
64 0.17
65 0.22
66 0.23
67 0.23
68 0.24
69 0.2
70 0.2
71 0.24
72 0.26
73 0.22
74 0.23
75 0.26
76 0.3
77 0.29
78 0.29
79 0.24
80 0.24
81 0.22
82 0.22
83 0.2
84 0.15
85 0.15
86 0.14
87 0.13
88 0.12
89 0.13
90 0.11
91 0.12
92 0.13
93 0.16
94 0.22
95 0.27
96 0.28
97 0.36
98 0.45
99 0.52
100 0.59
101 0.59
102 0.55
103 0.5
104 0.49
105 0.44
106 0.4
107 0.34
108 0.26
109 0.23
110 0.2
111 0.19
112 0.18
113 0.14
114 0.09
115 0.08
116 0.08
117 0.08
118 0.1
119 0.13
120 0.19
121 0.22
122 0.26
123 0.31
124 0.38
125 0.47
126 0.54
127 0.54
128 0.48
129 0.51
130 0.56
131 0.55
132 0.54
133 0.53
134 0.53
135 0.61
136 0.72
137 0.77
138 0.78
139 0.82
140 0.86
141 0.85
142 0.83
143 0.79
144 0.76
145 0.69
146 0.61
147 0.54
148 0.45
149 0.38
150 0.3
151 0.24
152 0.16
153 0.14
154 0.12
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.08
164 0.07
165 0.06
166 0.06
167 0.06
168 0.08
169 0.07
170 0.05
171 0.05
172 0.06
173 0.06
174 0.07
175 0.12
176 0.11
177 0.12
178 0.13
179 0.15
180 0.17
181 0.2
182 0.2
183 0.16
184 0.18
185 0.2
186 0.22
187 0.22
188 0.22
189 0.25
190 0.25
191 0.28
192 0.3
193 0.27
194 0.25
195 0.24
196 0.24
197 0.21
198 0.2
199 0.18
200 0.15
201 0.16
202 0.15
203 0.16
204 0.18
205 0.18
206 0.19
207 0.17
208 0.17
209 0.15
210 0.15
211 0.14
212 0.1
213 0.09
214 0.09
215 0.11
216 0.11
217 0.12
218 0.12
219 0.11
220 0.11
221 0.1
222 0.1
223 0.09
224 0.08
225 0.07
226 0.08
227 0.08
228 0.08
229 0.07
230 0.07
231 0.06
232 0.07
233 0.07
234 0.06
235 0.07
236 0.08
237 0.09
238 0.1
239 0.12
240 0.13
241 0.14
242 0.16
243 0.18
244 0.22
245 0.23
246 0.24
247 0.22
248 0.24
249 0.23
250 0.22
251 0.19
252 0.16
253 0.13
254 0.12
255 0.11
256 0.09
257 0.12
258 0.14
259 0.15
260 0.2
261 0.26
262 0.28
263 0.3
264 0.3
265 0.29
266 0.28
267 0.3
268 0.27
269 0.23
270 0.21
271 0.21
272 0.23
273 0.24
274 0.27
275 0.24
276 0.21
277 0.2
278 0.2
279 0.2
280 0.19
281 0.19
282 0.16
283 0.15
284 0.2
285 0.19
286 0.2
287 0.23
288 0.27
289 0.27
290 0.32
291 0.38
292 0.36
293 0.46
294 0.55
295 0.61
296 0.61
297 0.65
298 0.68
299 0.73
300 0.77
301 0.72
302 0.67
303 0.67
304 0.67
305 0.67
306 0.62
307 0.59
308 0.55
309 0.54
310 0.55
311 0.53