Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NS22

Protein Details
Accession A0A2A9NS22    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
194-215REQGRRGKGGHKKRKLEDRLVVBasic
NLS Segment(s)
PositionSequence
197-208GRRGKGGHKKRK
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MERLPVELLYEVQLLALSPSFPLTSRGIHMVFKQAPASYYAQYILSRTTAQKQMTVNETYSRALRYPLCSKEVVDVLHRLMGLGNATHTFICELPRRLFRSLKPKPPNQAWQENDYPLPFLQYLYGAPALPRPDSNSHEGYALTRAVHARHEPLVRFLLERGASPKYKGGLCVKIAIRQKHLDLVRMLIEREDREQGRRGKGGHKKRKLEDRLVVDQGMVRLAVKAGARDIVQYLTQVKGVIPNMQTLLDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.06
5 0.06
6 0.07
7 0.08
8 0.09
9 0.12
10 0.13
11 0.15
12 0.18
13 0.22
14 0.22
15 0.24
16 0.25
17 0.3
18 0.3
19 0.29
20 0.29
21 0.25
22 0.24
23 0.26
24 0.28
25 0.2
26 0.19
27 0.18
28 0.18
29 0.18
30 0.18
31 0.16
32 0.15
33 0.16
34 0.17
35 0.22
36 0.26
37 0.27
38 0.3
39 0.31
40 0.33
41 0.35
42 0.35
43 0.31
44 0.27
45 0.28
46 0.25
47 0.25
48 0.23
49 0.19
50 0.19
51 0.21
52 0.23
53 0.29
54 0.31
55 0.32
56 0.31
57 0.32
58 0.32
59 0.32
60 0.27
61 0.22
62 0.2
63 0.18
64 0.18
65 0.17
66 0.14
67 0.11
68 0.11
69 0.09
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.11
79 0.15
80 0.19
81 0.22
82 0.28
83 0.31
84 0.34
85 0.38
86 0.39
87 0.45
88 0.5
89 0.57
90 0.58
91 0.6
92 0.63
93 0.66
94 0.69
95 0.64
96 0.65
97 0.57
98 0.55
99 0.52
100 0.46
101 0.4
102 0.32
103 0.27
104 0.17
105 0.16
106 0.11
107 0.09
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.06
114 0.06
115 0.09
116 0.1
117 0.1
118 0.1
119 0.12
120 0.15
121 0.18
122 0.22
123 0.22
124 0.21
125 0.21
126 0.21
127 0.18
128 0.16
129 0.14
130 0.1
131 0.09
132 0.1
133 0.1
134 0.12
135 0.12
136 0.13
137 0.16
138 0.19
139 0.19
140 0.2
141 0.22
142 0.2
143 0.2
144 0.18
145 0.18
146 0.15
147 0.16
148 0.16
149 0.18
150 0.18
151 0.19
152 0.21
153 0.19
154 0.19
155 0.23
156 0.25
157 0.27
158 0.27
159 0.32
160 0.31
161 0.35
162 0.41
163 0.4
164 0.39
165 0.37
166 0.37
167 0.38
168 0.38
169 0.36
170 0.3
171 0.28
172 0.28
173 0.26
174 0.25
175 0.2
176 0.21
177 0.18
178 0.2
179 0.25
180 0.22
181 0.24
182 0.32
183 0.36
184 0.39
185 0.42
186 0.42
187 0.45
188 0.54
189 0.62
190 0.66
191 0.69
192 0.72
193 0.77
194 0.85
195 0.84
196 0.83
197 0.8
198 0.77
199 0.74
200 0.68
201 0.59
202 0.49
203 0.42
204 0.34
205 0.26
206 0.18
207 0.11
208 0.08
209 0.08
210 0.11
211 0.1
212 0.11
213 0.11
214 0.14
215 0.14
216 0.14
217 0.16
218 0.15
219 0.14
220 0.15
221 0.16
222 0.15
223 0.16
224 0.15
225 0.14
226 0.18
227 0.19
228 0.23
229 0.22
230 0.24
231 0.24