Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1DZK4

Protein Details
Accession A0A0D1DZK4   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
139-165LQQADARRKKHTKIKRADVKSGRKFKGBasic
NLS Segment(s)
PositionSequence
144-165ARRKKHTKIKRADVKSGRKFKG
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0016150  F:translation release factor activity, codon nonspecific  
GO:0070126  P:mitochondrial translational termination  
KEGG uma:UMAG_11747  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MQERRRWLSNFQELSLRRSDFQVSFSRSSGPGGQNVNKLNTKANVRLDLSQAASHAPDALDASHPRKWLNRDLVSRIAKQSPYYVASDHSLLITSMRHRTQEANVQDALEKMHAHLLELAQDGLVGETSQQQRDRVRRLQQADARRKKHTKIKRADVKSGRKFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.42
4 0.33
5 0.32
6 0.35
7 0.28
8 0.31
9 0.35
10 0.34
11 0.35
12 0.34
13 0.35
14 0.3
15 0.32
16 0.34
17 0.27
18 0.26
19 0.29
20 0.32
21 0.35
22 0.37
23 0.4
24 0.36
25 0.36
26 0.34
27 0.33
28 0.34
29 0.35
30 0.36
31 0.36
32 0.35
33 0.36
34 0.34
35 0.32
36 0.28
37 0.23
38 0.19
39 0.15
40 0.13
41 0.11
42 0.1
43 0.07
44 0.06
45 0.06
46 0.06
47 0.09
48 0.11
49 0.14
50 0.16
51 0.17
52 0.18
53 0.22
54 0.25
55 0.3
56 0.36
57 0.4
58 0.41
59 0.44
60 0.51
61 0.5
62 0.47
63 0.42
64 0.36
65 0.3
66 0.27
67 0.24
68 0.19
69 0.17
70 0.17
71 0.15
72 0.13
73 0.14
74 0.14
75 0.12
76 0.1
77 0.08
78 0.07
79 0.07
80 0.07
81 0.08
82 0.12
83 0.13
84 0.14
85 0.15
86 0.17
87 0.19
88 0.27
89 0.27
90 0.26
91 0.25
92 0.24
93 0.23
94 0.22
95 0.19
96 0.12
97 0.1
98 0.07
99 0.11
100 0.1
101 0.1
102 0.11
103 0.1
104 0.11
105 0.12
106 0.11
107 0.08
108 0.08
109 0.07
110 0.06
111 0.06
112 0.04
113 0.04
114 0.1
115 0.13
116 0.17
117 0.19
118 0.23
119 0.3
120 0.38
121 0.46
122 0.48
123 0.55
124 0.6
125 0.63
126 0.69
127 0.68
128 0.72
129 0.75
130 0.77
131 0.73
132 0.74
133 0.76
134 0.74
135 0.78
136 0.77
137 0.77
138 0.78
139 0.84
140 0.85
141 0.86
142 0.88
143 0.88
144 0.88
145 0.88