Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NZ36

Protein Details
Accession A0A2A9NZ36   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-147KDNQLKSEKEEKKRRKAQKKEQRRVRREMRRLERDKLBasic
NLS Segment(s)
PositionSequence
118-147EKEEKKRRKAQKKEQRRVRREMRRLERDKL
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MFEPVRGGTRGGQAEFKWSDVSADKDREHYLGHSINAPTGRWQRNKDVHWYSRNTQNITEDEKQEILKIKELETAALAVALGFEPVSKTSQLDAALPTETRSPPQTSHETKDNQLKSEKEEKKRRKAQKKEQRRVRREMRRLERDKLPSGSSGTHHRSIRLRSSSPLPRGVHEGIYFSRSRNRSPSPSRYQHQTGRSERDLVRRYTSRAESRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.31
4 0.26
5 0.22
6 0.23
7 0.22
8 0.28
9 0.27
10 0.31
11 0.31
12 0.33
13 0.35
14 0.33
15 0.32
16 0.27
17 0.27
18 0.24
19 0.24
20 0.26
21 0.24
22 0.26
23 0.26
24 0.25
25 0.26
26 0.32
27 0.39
28 0.41
29 0.45
30 0.52
31 0.59
32 0.61
33 0.64
34 0.64
35 0.64
36 0.65
37 0.67
38 0.61
39 0.61
40 0.64
41 0.56
42 0.49
43 0.45
44 0.41
45 0.42
46 0.41
47 0.34
48 0.31
49 0.3
50 0.28
51 0.26
52 0.28
53 0.22
54 0.24
55 0.23
56 0.22
57 0.24
58 0.24
59 0.22
60 0.17
61 0.16
62 0.11
63 0.1
64 0.09
65 0.04
66 0.04
67 0.04
68 0.03
69 0.02
70 0.03
71 0.03
72 0.04
73 0.06
74 0.06
75 0.07
76 0.07
77 0.09
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.13
90 0.14
91 0.18
92 0.25
93 0.26
94 0.3
95 0.35
96 0.34
97 0.36
98 0.43
99 0.4
100 0.35
101 0.35
102 0.32
103 0.32
104 0.4
105 0.45
106 0.47
107 0.56
108 0.63
109 0.7
110 0.79
111 0.84
112 0.84
113 0.88
114 0.89
115 0.9
116 0.92
117 0.92
118 0.93
119 0.93
120 0.9
121 0.88
122 0.88
123 0.87
124 0.85
125 0.85
126 0.84
127 0.83
128 0.82
129 0.78
130 0.75
131 0.7
132 0.66
133 0.58
134 0.49
135 0.4
136 0.37
137 0.33
138 0.27
139 0.3
140 0.3
141 0.33
142 0.33
143 0.35
144 0.38
145 0.41
146 0.48
147 0.46
148 0.43
149 0.4
150 0.48
151 0.52
152 0.51
153 0.54
154 0.47
155 0.42
156 0.46
157 0.44
158 0.39
159 0.31
160 0.31
161 0.24
162 0.26
163 0.25
164 0.21
165 0.28
166 0.27
167 0.3
168 0.35
169 0.41
170 0.47
171 0.55
172 0.64
173 0.65
174 0.72
175 0.72
176 0.73
177 0.73
178 0.71
179 0.7
180 0.7
181 0.68
182 0.68
183 0.66
184 0.64
185 0.61
186 0.63
187 0.61
188 0.56
189 0.56
190 0.52
191 0.53
192 0.55
193 0.59