Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NVJ0

Protein Details
Accession A0A2A9NVJ0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-61VTRGSGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
42-53GFRKEKNKKKRG
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences RIDPSKISNSAVVDNRYEAKAGPANDYGQRAHKDLSVTRGSGFRKEKNKKKRGSYRGGEITMESHSYKFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.26
4 0.24
5 0.18
6 0.17
7 0.19
8 0.19
9 0.2
10 0.2
11 0.21
12 0.23
13 0.25
14 0.22
15 0.23
16 0.24
17 0.22
18 0.21
19 0.2
20 0.2
21 0.2
22 0.24
23 0.2
24 0.19
25 0.18
26 0.22
27 0.21
28 0.27
29 0.3
30 0.32
31 0.41
32 0.51
33 0.6
34 0.67
35 0.75
36 0.77
37 0.83
38 0.87
39 0.86
40 0.86
41 0.83
42 0.81
43 0.8
44 0.73
45 0.63
46 0.53
47 0.44
48 0.36
49 0.32
50 0.23