Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NR90

Protein Details
Accession A0A2A9NR90   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
145-164TLSYLHKLRKQRKKVFVVTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9.5, nucl 8.5, cyto_mito 8.166, cyto_nucl 7.666, cyto 5.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR006282  Thi_PPkinase  
IPR016966  Thiamin_pyrophosphokinase_euk  
IPR007373  Thiamin_PyroPKinase_B1-bd  
IPR036371  TPK_B1-bd_sf  
IPR007371  TPK_catalytic  
IPR036759  TPK_catalytic_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016301  F:kinase activity  
GO:0030975  F:thiamine binding  
GO:0004788  F:thiamine diphosphokinase activity  
GO:0016310  P:phosphorylation  
GO:0009229  P:thiamine diphosphate biosynthetic process  
GO:0006772  P:thiamine metabolic process  
Pfam View protein in Pfam  
PF04265  TPK_B1_binding  
PF04263  TPK_catalytic  
CDD cd07995  TPK  
Amino Acid Sequences MRKVSVWDVKFLDPCLKPSEDVRRALVIVNQSFSFSLLNRLWSCTQWHCCADGGANRLFDLLGELQANGGYLPDLIKGDLDSLRDDVRKYYVAKGVCLVRDHDQDSTDLMKCVSSLQELERREGCEYELLLLGGLSGRLDQTIHTLSYLHKLRKQRKKVFVVTDDSVGWVLDSGEHTIKIDHGLVGKTCGLLPVGVDCTVLSTSGLEWDLTDRASSFDGMISTSNHLIPGRDVWIKTTKPIWWTVEMRPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.31
5 0.36
6 0.45
7 0.43
8 0.44
9 0.44
10 0.41
11 0.4
12 0.4
13 0.36
14 0.33
15 0.28
16 0.28
17 0.25
18 0.23
19 0.23
20 0.22
21 0.2
22 0.13
23 0.17
24 0.16
25 0.22
26 0.21
27 0.26
28 0.26
29 0.27
30 0.31
31 0.32
32 0.37
33 0.36
34 0.37
35 0.34
36 0.33
37 0.33
38 0.32
39 0.29
40 0.27
41 0.25
42 0.24
43 0.22
44 0.21
45 0.2
46 0.16
47 0.14
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.09
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.08
66 0.09
67 0.1
68 0.1
69 0.11
70 0.13
71 0.14
72 0.14
73 0.14
74 0.15
75 0.17
76 0.18
77 0.2
78 0.23
79 0.22
80 0.22
81 0.24
82 0.24
83 0.23
84 0.23
85 0.21
86 0.2
87 0.23
88 0.24
89 0.21
90 0.19
91 0.18
92 0.18
93 0.18
94 0.15
95 0.12
96 0.11
97 0.1
98 0.09
99 0.1
100 0.08
101 0.06
102 0.07
103 0.09
104 0.15
105 0.16
106 0.18
107 0.19
108 0.2
109 0.2
110 0.19
111 0.17
112 0.13
113 0.12
114 0.1
115 0.09
116 0.08
117 0.07
118 0.06
119 0.05
120 0.04
121 0.04
122 0.03
123 0.02
124 0.03
125 0.03
126 0.03
127 0.03
128 0.06
129 0.08
130 0.08
131 0.08
132 0.09
133 0.09
134 0.17
135 0.22
136 0.22
137 0.26
138 0.35
139 0.45
140 0.55
141 0.65
142 0.68
143 0.72
144 0.78
145 0.81
146 0.8
147 0.75
148 0.7
149 0.61
150 0.53
151 0.43
152 0.35
153 0.27
154 0.19
155 0.13
156 0.07
157 0.06
158 0.05
159 0.06
160 0.07
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.1
167 0.1
168 0.09
169 0.1
170 0.11
171 0.11
172 0.13
173 0.13
174 0.12
175 0.12
176 0.11
177 0.09
178 0.08
179 0.08
180 0.08
181 0.1
182 0.09
183 0.1
184 0.09
185 0.1
186 0.1
187 0.1
188 0.08
189 0.07
190 0.07
191 0.08
192 0.09
193 0.07
194 0.08
195 0.09
196 0.1
197 0.1
198 0.1
199 0.09
200 0.1
201 0.11
202 0.11
203 0.1
204 0.1
205 0.1
206 0.1
207 0.11
208 0.11
209 0.13
210 0.14
211 0.14
212 0.15
213 0.16
214 0.16
215 0.16
216 0.17
217 0.2
218 0.23
219 0.23
220 0.25
221 0.33
222 0.33
223 0.35
224 0.37
225 0.36
226 0.35
227 0.41
228 0.41
229 0.41
230 0.44