Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5INK3

Protein Details
Accession V5INK3    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SVPAPAPKKLEKKPIKFSNLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11.5, cyto 6.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0042645  C:mitochondrial nucleoid  
GO:0005739  C:mitochondrion  
GO:0003677  F:DNA binding  
GO:0005371  F:tricarboxylate secondary active transmembrane transporter activity  
GO:0015742  P:alpha-ketoglutarate transport  
GO:0006843  P:mitochondrial citrate transmembrane transport  
GO:0000002  P:mitochondrial genome maintenance  
KEGG ncr:NCU01689  -  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MSAAVASVPAPAPKKLEKKPIKFSNLLLGAGLNLFEVTTLGQPLEVIKTTMAANRNDGFTSALRRIWNRGGIFGFYQGLIPWAWIEGSTKGAVLLFVASEAEYHARAAGAGDFVAGITGGIVGGVAQAYATMGFCTCMKTVEITKHKMSAAGQKAPGTWATFMDIYRREGIRGINKGVNAVAIRQMTNWGSRFGLSRLAEQGIRKATGKEEGQKLAAWEKILASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKMTVGNTFRYIYQTNGIKGLYRGVTPRIGLSIWQTVCMVAFGDMAKTYVEKLTGDAVTAKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.56
4 0.62
5 0.69
6 0.78
7 0.83
8 0.82
9 0.76
10 0.7
11 0.69
12 0.62
13 0.53
14 0.42
15 0.32
16 0.25
17 0.21
18 0.19
19 0.09
20 0.05
21 0.05
22 0.04
23 0.05
24 0.05
25 0.06
26 0.07
27 0.06
28 0.06
29 0.07
30 0.08
31 0.11
32 0.1
33 0.1
34 0.09
35 0.11
36 0.12
37 0.16
38 0.2
39 0.19
40 0.23
41 0.24
42 0.25
43 0.24
44 0.24
45 0.22
46 0.19
47 0.23
48 0.21
49 0.23
50 0.25
51 0.26
52 0.3
53 0.33
54 0.38
55 0.33
56 0.34
57 0.32
58 0.31
59 0.3
60 0.26
61 0.22
62 0.15
63 0.15
64 0.11
65 0.11
66 0.08
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.08
73 0.07
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.06
123 0.07
124 0.07
125 0.08
126 0.1
127 0.12
128 0.2
129 0.25
130 0.28
131 0.29
132 0.3
133 0.3
134 0.29
135 0.28
136 0.28
137 0.28
138 0.27
139 0.27
140 0.25
141 0.25
142 0.25
143 0.24
144 0.17
145 0.12
146 0.09
147 0.09
148 0.1
149 0.1
150 0.12
151 0.13
152 0.14
153 0.16
154 0.16
155 0.15
156 0.16
157 0.19
158 0.21
159 0.23
160 0.24
161 0.23
162 0.23
163 0.23
164 0.21
165 0.19
166 0.13
167 0.11
168 0.11
169 0.1
170 0.1
171 0.1
172 0.12
173 0.12
174 0.15
175 0.16
176 0.14
177 0.13
178 0.14
179 0.15
180 0.14
181 0.2
182 0.18
183 0.18
184 0.19
185 0.2
186 0.21
187 0.2
188 0.23
189 0.18
190 0.19
191 0.18
192 0.17
193 0.17
194 0.21
195 0.24
196 0.26
197 0.28
198 0.28
199 0.29
200 0.28
201 0.28
202 0.26
203 0.24
204 0.18
205 0.14
206 0.13
207 0.13
208 0.12
209 0.11
210 0.08
211 0.07
212 0.06
213 0.05
214 0.05
215 0.04
216 0.03
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.07
224 0.09
225 0.09
226 0.1
227 0.11
228 0.13
229 0.16
230 0.19
231 0.2
232 0.23
233 0.25
234 0.31
235 0.38
236 0.45
237 0.54
238 0.61
239 0.69
240 0.69
241 0.7
242 0.68
243 0.7
244 0.69
245 0.69
246 0.67
247 0.61
248 0.61
249 0.59
250 0.54
251 0.49
252 0.41
253 0.33
254 0.31
255 0.31
256 0.27
257 0.29
258 0.29
259 0.26
260 0.25
261 0.28
262 0.22
263 0.2
264 0.21
265 0.22
266 0.24
267 0.23
268 0.24
269 0.2
270 0.19
271 0.18
272 0.2
273 0.25
274 0.22
275 0.23
276 0.22
277 0.2
278 0.2
279 0.19
280 0.16
281 0.08
282 0.09
283 0.08
284 0.09
285 0.09
286 0.1
287 0.1
288 0.1
289 0.11
290 0.12
291 0.13
292 0.12
293 0.13
294 0.17
295 0.17
296 0.18