Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NKC2

Protein Details
Accession A0A2A9NKC2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28DIISSKKVSRRPTRRTTSRVSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10.166, nucl 8, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MDKTLDDIISSKKVSRRPTRRTTSRVSVLGMTGVSPSARARVAAGATPTTTPTNTTADKIIVSNLPADVNEVQIKELFHSTVGPLREVTLHYDSAGRSKGVAAVHFQRKGDGTKAYQQYNNRLIDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.59
4 0.64
5 0.73
6 0.79
7 0.83
8 0.84
9 0.82
10 0.8
11 0.76
12 0.68
13 0.6
14 0.5
15 0.41
16 0.35
17 0.27
18 0.18
19 0.11
20 0.09
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.1
29 0.11
30 0.12
31 0.13
32 0.11
33 0.12
34 0.12
35 0.13
36 0.12
37 0.11
38 0.11
39 0.12
40 0.15
41 0.15
42 0.16
43 0.15
44 0.14
45 0.15
46 0.13
47 0.12
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.06
54 0.08
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.11
69 0.12
70 0.12
71 0.11
72 0.11
73 0.12
74 0.13
75 0.17
76 0.15
77 0.15
78 0.14
79 0.16
80 0.16
81 0.18
82 0.19
83 0.14
84 0.12
85 0.12
86 0.15
87 0.15
88 0.16
89 0.17
90 0.24
91 0.32
92 0.34
93 0.34
94 0.33
95 0.34
96 0.36
97 0.35
98 0.33
99 0.3
100 0.36
101 0.42
102 0.45
103 0.48
104 0.51
105 0.56
106 0.58
107 0.56