Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NXZ8

Protein Details
Accession A0A2A9NXZ8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRMTKHESSLKTLRQKKKDQNFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-112LRPKKTRAIRRRMTKHESSLKTLRQKKKD
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLAKQLHDLKNELLQLRVQKIAGGPASKLTKIATVRKSIARVLTVMNQKARQNLREYYKNKKYIPLDLRPKKTRAIRRRMTKHESSLKTLRQKKKDQNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.45
4 0.5
5 0.47
6 0.46
7 0.49
8 0.55
9 0.54
10 0.51
11 0.51
12 0.43
13 0.42
14 0.39
15 0.33
16 0.24
17 0.22
18 0.24
19 0.24
20 0.24
21 0.2
22 0.17
23 0.17
24 0.2
25 0.19
26 0.16
27 0.14
28 0.17
29 0.2
30 0.19
31 0.19
32 0.15
33 0.18
34 0.21
35 0.28
36 0.27
37 0.29
38 0.31
39 0.33
40 0.35
41 0.31
42 0.29
43 0.22
44 0.2
45 0.17
46 0.2
47 0.22
48 0.22
49 0.23
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.42
59 0.44
60 0.48
61 0.54
62 0.59
63 0.56
64 0.58
65 0.54
66 0.54
67 0.58
68 0.58
69 0.6
70 0.62
71 0.7
72 0.68
73 0.67
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.81
85 0.79
86 0.79
87 0.73
88 0.7
89 0.68
90 0.67
91 0.69
92 0.72
93 0.72
94 0.71
95 0.78
96 0.81
97 0.84
98 0.87
99 0.88
100 0.89
101 0.9
102 0.87
103 0.87
104 0.81