Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S0A6

Protein Details
Accession Q7S0A6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33SSWSLCCRWTPKRTKWTPDGKDKAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
KEGG ncr:NCU06872  -  
Amino Acid Sequences MRLVAMWDSSWSLCCRWTPKRTKWTPDGKDKAQYLASTKGVPRSDCNRGTSTKLWRSEAARMWYNYGLIGYSSAFENLTGTKLPHKLRSSLFIGQKLQVAQVVARCLTGLRQVPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.34
4 0.44
5 0.51
6 0.6
7 0.7
8 0.76
9 0.8
10 0.82
11 0.84
12 0.82
13 0.83
14 0.81
15 0.73
16 0.72
17 0.65
18 0.58
19 0.5
20 0.42
21 0.35
22 0.32
23 0.29
24 0.24
25 0.24
26 0.27
27 0.27
28 0.27
29 0.28
30 0.29
31 0.35
32 0.36
33 0.39
34 0.35
35 0.35
36 0.39
37 0.38
38 0.41
39 0.4
40 0.4
41 0.38
42 0.38
43 0.38
44 0.38
45 0.38
46 0.34
47 0.31
48 0.29
49 0.29
50 0.27
51 0.25
52 0.2
53 0.15
54 0.11
55 0.07
56 0.07
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.12
69 0.18
70 0.21
71 0.29
72 0.31
73 0.34
74 0.36
75 0.41
76 0.42
77 0.43
78 0.45
79 0.42
80 0.42
81 0.39
82 0.39
83 0.34
84 0.29
85 0.23
86 0.19
87 0.16
88 0.17
89 0.18
90 0.16
91 0.15
92 0.14
93 0.13
94 0.14
95 0.2
96 0.23