Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NEF9

Protein Details
Accession A0A2A9NEF9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTKKRRNGGRNKKGRGHVKFMRBasic
86-114VRSREGRRNRAPPPRVRWKDGKKVNQAVEHydrophilic
NLS Segment(s)
PositionSequence
3-17KKRRNGGRNKKGRGH
87-108RSREGRRNRAPPPRVRWKDGKK
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNGGRNKKGRGHVKFMRCSNCSRCVGKDKAIKRFTVRNMVESAAYRDISEASVYPEYTVPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNQAVEDAKTAAAASKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.83
3 0.81
4 0.79
5 0.77
6 0.77
7 0.75
8 0.73
9 0.65
10 0.66
11 0.62
12 0.61
13 0.57
14 0.52
15 0.5
16 0.5
17 0.52
18 0.53
19 0.56
20 0.54
21 0.59
22 0.59
23 0.56
24 0.52
25 0.56
26 0.52
27 0.54
28 0.48
29 0.4
30 0.39
31 0.37
32 0.34
33 0.27
34 0.26
35 0.17
36 0.17
37 0.14
38 0.12
39 0.12
40 0.11
41 0.11
42 0.07
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.11
49 0.11
50 0.11
51 0.09
52 0.09
53 0.1
54 0.11
55 0.14
56 0.13
57 0.16
58 0.17
59 0.17
60 0.16
61 0.16
62 0.16
63 0.13
64 0.13
65 0.13
66 0.18
67 0.17
68 0.21
69 0.23
70 0.28
71 0.29
72 0.31
73 0.34
74 0.36
75 0.42
76 0.48
77 0.54
78 0.6
79 0.67
80 0.72
81 0.75
82 0.77
83 0.79
84 0.79
85 0.79
86 0.8
87 0.78
88 0.76
89 0.78
90 0.77
91 0.79
92 0.8
93 0.8
94 0.79
95 0.81
96 0.8
97 0.74
98 0.68
99 0.61
100 0.53
101 0.46
102 0.36
103 0.27
104 0.22
105 0.18