Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IRQ0

Protein Details
Accession V5IRQ0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-120EEKAERKKQKKSQLGSWRYGHydrophilic
NLS Segment(s)
PositionSequence
75-111ALRKERKISGEAGDNKKRKKHNGETVEEKAERKKQKK
Subcellular Location(s) nucl 17, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
KEGG ncr:NCU16440  -  
Amino Acid Sequences MTGIRPGEDATPDTPLHPYPLQEWRVPWSHRNMFSRIKKLSAEADEHGVHQPLTHRLPCMVIAANNQDALPSQKALRKERKISGEAGDNKKRKKHNGETVEEKAERKKQKKSQLGSWRYGDRGNRSLEFVSDPVTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.21
5 0.21
6 0.21
7 0.29
8 0.32
9 0.32
10 0.33
11 0.32
12 0.38
13 0.4
14 0.4
15 0.41
16 0.45
17 0.5
18 0.53
19 0.54
20 0.57
21 0.61
22 0.65
23 0.57
24 0.53
25 0.46
26 0.44
27 0.44
28 0.37
29 0.33
30 0.26
31 0.27
32 0.25
33 0.25
34 0.24
35 0.19
36 0.15
37 0.13
38 0.14
39 0.14
40 0.18
41 0.17
42 0.17
43 0.17
44 0.18
45 0.17
46 0.17
47 0.13
48 0.1
49 0.11
50 0.13
51 0.13
52 0.12
53 0.12
54 0.1
55 0.09
56 0.11
57 0.1
58 0.08
59 0.1
60 0.12
61 0.18
62 0.26
63 0.36
64 0.4
65 0.45
66 0.51
67 0.55
68 0.54
69 0.51
70 0.45
71 0.44
72 0.45
73 0.48
74 0.51
75 0.5
76 0.52
77 0.57
78 0.6
79 0.61
80 0.63
81 0.65
82 0.67
83 0.71
84 0.74
85 0.75
86 0.73
87 0.71
88 0.62
89 0.54
90 0.49
91 0.49
92 0.52
93 0.5
94 0.56
95 0.59
96 0.68
97 0.76
98 0.76
99 0.78
100 0.8
101 0.8
102 0.77
103 0.73
104 0.67
105 0.59
106 0.58
107 0.53
108 0.5
109 0.48
110 0.47
111 0.43
112 0.42
113 0.41
114 0.37
115 0.34
116 0.28