Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S9I4

Protein Details
Accession Q7S9I4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
154-174ATRMSSRSKYGTKKPKKASVGHydrophilic
NLS Segment(s)
PositionSequence
166-170KKPKK
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU06542  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MATTFLRNLFSQAQPSLLRRPLMPSSSSILPAAARLFSSTPAQNATLNQVMRGCRKPQRARHAVSPALSSIKSPALKGVCVKVGITRPKKPNSGERKTARVRLSTGKVITAYIPGEGHNISQHSVVLVRGGRAQDCPGVRYHLVRGALDLAGVATRMSSRSKYGTKKPKKASVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.35
4 0.35
5 0.34
6 0.3
7 0.36
8 0.37
9 0.37
10 0.35
11 0.3
12 0.31
13 0.31
14 0.32
15 0.26
16 0.21
17 0.18
18 0.18
19 0.16
20 0.12
21 0.1
22 0.1
23 0.1
24 0.12
25 0.15
26 0.15
27 0.15
28 0.17
29 0.18
30 0.17
31 0.17
32 0.2
33 0.21
34 0.2
35 0.2
36 0.21
37 0.22
38 0.26
39 0.29
40 0.3
41 0.33
42 0.44
43 0.52
44 0.58
45 0.66
46 0.7
47 0.7
48 0.72
49 0.71
50 0.64
51 0.56
52 0.48
53 0.38
54 0.32
55 0.27
56 0.19
57 0.14
58 0.16
59 0.15
60 0.14
61 0.17
62 0.15
63 0.17
64 0.18
65 0.18
66 0.15
67 0.14
68 0.15
69 0.13
70 0.18
71 0.26
72 0.3
73 0.35
74 0.4
75 0.44
76 0.48
77 0.48
78 0.53
79 0.54
80 0.56
81 0.58
82 0.56
83 0.6
84 0.59
85 0.64
86 0.56
87 0.48
88 0.44
89 0.41
90 0.42
91 0.38
92 0.34
93 0.29
94 0.26
95 0.24
96 0.22
97 0.17
98 0.13
99 0.09
100 0.09
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.1
110 0.09
111 0.09
112 0.09
113 0.1
114 0.1
115 0.1
116 0.12
117 0.13
118 0.14
119 0.14
120 0.16
121 0.18
122 0.18
123 0.19
124 0.18
125 0.22
126 0.22
127 0.23
128 0.24
129 0.25
130 0.26
131 0.24
132 0.24
133 0.21
134 0.2
135 0.17
136 0.15
137 0.09
138 0.07
139 0.08
140 0.06
141 0.04
142 0.05
143 0.07
144 0.1
145 0.12
146 0.16
147 0.23
148 0.31
149 0.4
150 0.5
151 0.59
152 0.67
153 0.76
154 0.82