Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NF43

Protein Details
Accession A0A2A9NF43    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-132FAAAKGIQKKKKEKKEWDEERQEWHydrophilic
NLS Segment(s)
PositionSequence
93-123RAKPLPKPKPPTKWELFAAAKGIQKKKKEKK
170-174ERKAR
227-234KKPRGIKR
265-270RKESPR
276-307NVRKAVRHASKGEGAIALARKGEDGKKRKGRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MDVSNILASHAAKFQTTNVEKDIAIEVDPGYLTTADFNSIDEESYKWNLEEHLQSLARDGTQALINALFSLPTASSPEGPIAQLPPPTTELPRAKPLPKPKPPTKWELFAAAKGIQKKKKEKKEWDEERQEWVDRWGKDGKNKQVEEQWLTEVPHNANIDHDPRKTAREERKARVAKNEKQRLQNLARAAETTPQESRKRDIERTLVQARTSTASMGRFDKQLEGEKKPRGIKRKFNPTETSADDERKASLALLTRMESDDKKMRKESPREGNIVNVRKAVRHASKGEGAIALARKGEDGKKRKGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.26
3 0.28
4 0.29
5 0.29
6 0.3
7 0.29
8 0.3
9 0.31
10 0.21
11 0.18
12 0.16
13 0.14
14 0.12
15 0.13
16 0.11
17 0.09
18 0.08
19 0.08
20 0.09
21 0.09
22 0.1
23 0.1
24 0.11
25 0.12
26 0.12
27 0.13
28 0.12
29 0.12
30 0.14
31 0.17
32 0.17
33 0.15
34 0.16
35 0.16
36 0.2
37 0.22
38 0.19
39 0.23
40 0.23
41 0.23
42 0.24
43 0.24
44 0.2
45 0.17
46 0.16
47 0.11
48 0.11
49 0.12
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.07
56 0.05
57 0.06
58 0.05
59 0.06
60 0.09
61 0.09
62 0.1
63 0.11
64 0.13
65 0.12
66 0.12
67 0.13
68 0.12
69 0.13
70 0.15
71 0.14
72 0.15
73 0.18
74 0.19
75 0.2
76 0.26
77 0.29
78 0.3
79 0.37
80 0.4
81 0.4
82 0.45
83 0.54
84 0.57
85 0.61
86 0.67
87 0.69
88 0.74
89 0.75
90 0.77
91 0.71
92 0.65
93 0.57
94 0.56
95 0.48
96 0.39
97 0.37
98 0.31
99 0.3
100 0.31
101 0.37
102 0.34
103 0.41
104 0.51
105 0.58
106 0.65
107 0.73
108 0.78
109 0.8
110 0.86
111 0.88
112 0.88
113 0.87
114 0.77
115 0.73
116 0.64
117 0.55
118 0.44
119 0.39
120 0.35
121 0.26
122 0.28
123 0.29
124 0.29
125 0.35
126 0.42
127 0.46
128 0.48
129 0.49
130 0.47
131 0.46
132 0.47
133 0.43
134 0.36
135 0.3
136 0.22
137 0.23
138 0.22
139 0.19
140 0.16
141 0.17
142 0.16
143 0.14
144 0.14
145 0.15
146 0.18
147 0.19
148 0.19
149 0.18
150 0.18
151 0.21
152 0.23
153 0.3
154 0.35
155 0.42
156 0.49
157 0.51
158 0.6
159 0.63
160 0.62
161 0.64
162 0.63
163 0.6
164 0.64
165 0.69
166 0.64
167 0.66
168 0.67
169 0.64
170 0.59
171 0.56
172 0.48
173 0.4
174 0.35
175 0.29
176 0.27
177 0.24
178 0.21
179 0.19
180 0.19
181 0.23
182 0.27
183 0.28
184 0.31
185 0.34
186 0.39
187 0.4
188 0.42
189 0.43
190 0.43
191 0.49
192 0.51
193 0.45
194 0.4
195 0.37
196 0.33
197 0.28
198 0.24
199 0.18
200 0.14
201 0.15
202 0.17
203 0.19
204 0.19
205 0.18
206 0.19
207 0.2
208 0.21
209 0.28
210 0.31
211 0.35
212 0.4
213 0.43
214 0.49
215 0.54
216 0.58
217 0.59
218 0.63
219 0.67
220 0.7
221 0.77
222 0.77
223 0.76
224 0.75
225 0.69
226 0.66
227 0.59
228 0.56
229 0.47
230 0.44
231 0.39
232 0.34
233 0.3
234 0.25
235 0.21
236 0.15
237 0.14
238 0.16
239 0.17
240 0.18
241 0.19
242 0.19
243 0.2
244 0.23
245 0.22
246 0.23
247 0.3
248 0.32
249 0.37
250 0.4
251 0.48
252 0.54
253 0.63
254 0.66
255 0.68
256 0.71
257 0.7
258 0.66
259 0.66
260 0.66
261 0.64
262 0.56
263 0.5
264 0.44
265 0.4
266 0.43
267 0.44
268 0.42
269 0.41
270 0.43
271 0.44
272 0.48
273 0.48
274 0.46
275 0.37
276 0.3
277 0.28
278 0.26
279 0.21
280 0.17
281 0.16
282 0.15
283 0.19
284 0.26
285 0.32
286 0.38
287 0.48